Recombinant Human Gap junction alpha-8 protein (GJA8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
GJA8; Gap junction alpha-8 protein; Connexin-50; Cx50; Lens fiber protein MP70
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-433
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
GJA8
Target Protein Sequence
GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLMYVGHAVHYVRMEEKRKSREAEELGQQAGTN GGPDQGSVKKSSGSKGTKKFRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPLY RCSRWPCPNVVDCFVSRPTEKTIFILFMLSVASVSLFLNVMELGHLGLKGIRSALKRPVE QPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFE EKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQ EKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSK ASSRARSDDLTV
Uniprot No.

Target Background

Function
Gap junction alpha-8 protein (GJA8) is a structural component of eye lens gap junctions. Gap junctions are dodecameric channels that connect the cytoplasm of adjacent cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell via the central pore.
Gene References Into Functions
  1. This study identified the genetic susceptibility of GJA8 polymorphisms on age-related cataract (ARC) and provides new insights into the pathological mechanism of GJA8 variants in affecting lens opacity. PMID: 30349978
  2. The c.139G>A mutation in the GJA8 gene detected in this study was previously reported in Caucasian and Chinese families, but with different phenotypes, i.e., nuclear and nuclear pulverulent cataracts. Therefore, the c.139G>A mutation in GJA8 appears to exhibit marked interfamilial phenotypic variability. PMID: 30262699
  3. The p.V44M mutation in the GJA8 gene was the most prevalent mutation and was attributed to a founder effect within the Chinese congenital cataract cohort studied. PMID: 30078984
  4. GJA8 is newly identified as a genetic cause of familial congenital cataract. PMID: 29434075
  5. Data indicate de novo heterozygous mutations affecting the same codon of gap junction alpha-8 protein (GJA8) p.(Gly94Glu) and p.(Gly94Arg) )in 2 of the probands, in addition to the p.(Asp51Asn) mutation previously identified in the third case. PMID: 28455998
  6. The study identified two novel missense mutations within P59 and R76 of Cx50 that are associated with autosomal dominant congenital cataracts (ADCC). Functional analysis showed that Cx50R76H localized at appositional membranes forming gap junctions with enormous cytoplasmic protein accumulation, whereas the Cx50P59A mutation was found inefficient at forming detectable plaques. PMID: 27216975
  7. The novel insert mutation in the TM2 domain of Cx50 protein, which impairs its trafficking to the cell membrane and gap-junction function, is associated with cataract formation in this Chinese pedigree. PMID: 29489419
  8. The study demonstrates that the mutant protein localized to the plasma membrane and formed functional intercellular channels. These data suggest that GJA8 c.658A>G is most likely a benign rare variant. PMID: 28827829
  9. The missense mutation c.139G > A in GJA8 gene is associated with autosomal dominant congenital cataract in a six-generation Chinese family. The result of this present study provides further evidence that the p. D47N mutation in CX50 is a hot-spot mutation. PMID: 28526010
  10. The c.433G > T (p.G145W) mutation in the GJA8 gene was first reported to our knowledge. The results of our study would further expand the mutation spectrum of GJA8 associated with congenital cataract. PMID: 27785597
  11. These results indicated that the mutant Cx50 (S276F) might inhibit the function of gap junction channel in a dominant negative manner, but inhibit the hemichannel function in a recessive negative manner. PMID: 26174669
  12. GJA8 mutation (p.V44A) is associated with autosomal dominant congenital cataract. PMID: 25517998
  13. This is a novel missense mutation [c.829C > T, (p.H277Y)] identified in exon 2 of Cx50. PMID: 25947639
  14. We have used trio-based exome sequencing to uncover a recurrent missense mutation in CRYGD and two novel missense mutations in GJA8 associated with autosomal dominant cataract in three nuclear families. PMID: 25403472
  15. The molecular consequences of the p.P88T mutation in GJA8 include changes in connexin 50 protein localization patterns. PMID: 24535056
  16. A recurrent missense mutation c.773C>T (p.S258F) in exon 2 of the gap junction protein alpha 8 gene (GJA8) was identified in the proband with nuclear cataract. PMID: 25301372
  17. Structural bases of the varied functional consequences of Cx50 missense mutations were determined. PMID: 25003127
  18. Exome sequencing in developmental eye disease leads to the identification of causal variants in GJA8, CRYGC, PAX6, and CYP1B1. PMID: 24281366
  19. The results provide a molecular basis for the formation of various cataract phenotypes in human patients with Cx50 mutations. PMID: 24005045
  20. A novel G>A mutation of GJA8 in a three-generation Chinese pedigree was associated with perinuclear opacities of the lens involving the nucleus. PMID: 23555834
  21. Data indicate that after inhibition of new protein synthesis with cycloheximide, CX50fs disappeared much more rapidly than CX50, suggesting increased degradation of the mutant. PMID: 23720739
  22. A novel connexin 50 gene (GJA8) mutation, resulting in the amino substitution p. D47H in a Chinese family with nuclear and zonular pulverulent congenital cataracts, is reported. PMID: 23592913
  23. A PDZ-binding motif and ZO-1 protein are necessary for Cx50 intercellular channel formation. PMID: 21965293
  24. A missense D47N mutation in GJA8 is associated with autosomal dominant congenital cataract in a Chinese family. PMID: 21921990
  25. Mutations in GJA8 and CRYAA were identified in three Chinese families with cataract and microcornea. PMID: 21686328
  26. The G46V and W45S mutations of connexin 50 are in adjacent amino acids. W45S inhibits gap junctional channel function while G46V reduces cell viability by forming open hemichannels. PMID: 21228318
  27. Two novel nonsynonymous variations and four reported variations in CRYAB, CRYGC, CRYGD, and GJA8 were observed. PMID: 21423869
  28. Gap junction protein-alpha 8 polymorphisms may have a role in age-related cataracts. PMID: 20582632
  29. The D47N mutation of Cx50 causes the hereditary nuclear cataract in this family in an autosomal dominant mode of inheritance with incomplete penetrance. PMID: 21174522
  30. This report is the first to relate the p.R198W mutation in GJA8 with congenital cataract-microcornea syndrome. PMID: 20806042
  31. This study has identified a novel missense mutation located in the carboxyl terminus of GJA8 (S258F) associated with autosomal dominant nuclear cataract. PMID: 20597646
  32. A novel mutation in GJA8 was detected in a Chinese family with autosomal dominant congenital nuclear cataract, providing clear evidence of a relationship between the genotype and the corresponding cataract phenotype. PMID: 20019893
  33. The C-terminus of human Cx50 is involved in pHi sensitivity but has little influence over single-channel conductance, voltage dependence, or gating kinetics. PMID: 11944087
  34. The study confirmed that GJA8 plays a vital role in maintaining human lens transparency, and its mutation could be the genetic defect causing autosomal dominant congenital cataract. PMID: 15696487
  35. The pulverulent cataract described in this family is associated with a novel GJA8 mutation and has a different clinical phenotype from previously described GJA8 mutants. PMID: 16397066
  36. This is the first report of mutations in GJA8 (connexin50) to be associated with autosomal dominant cataract and microcornea. PMID: 16604058
  37. Results demonstrated that Cx50 hemichannels gating control can be cooperated by CaM and Ca2+. PMID: 16740131
  38. Matched case-control and family study indicate that Cx50 may play a role in the genetic susceptibility to schizophrenia. PMID: 17412882
  39. Mutation of the gap junction protein alpha 8 (GJA8) gene causes autosomal recessive cataract. PMID: 17601931
  40. Five novel mutations in CRYAA, CRYGD, and GJA8 genes were detected in congenital cataract in association with microcornea. PMID: 17724170
  41. Pulverulent cataracts present in members of a family are associated with a novel mutation, Cx50D47N, that acts as a loss-of-function mutation. The consequent decrease in lens intercellular communication may contribute to cataract formation. PMID: 18006672
  42. A novel disease-causing mutation (D47Y) of GJA8 gene in a Chinese family with ADCC is reported. PMID: 18247306
  43. This is a novel mutation identified in the first transmembrane domain (M1) of GJA8. PMID: 18334946
  44. A novel GJA8 gene mutation was found to be associated with hereditary cataract in a Chinese congenital cataract family. PMID: 18334966
  45. The ins776G mutation most likely causes a recessive triangular cataract with variable expressivity of a weak phenotype in heterozygotes. PMID: 18483562
  46. A p.P88Q mutation in GJA8 associated with Y-sutural cataract in a family of Indian origin is reported. PMID: 18587493
  47. The biochemical results indirectly suggest a potential novel mechanism by which connexin mutants could lead to cataracts. PMID: 19684000
  48. Direct sequencing of the PCR product produced from lens cDNA showed that the proband was heterozygous for a G>T transition at position 741 of the GJA8 gene, encoding the exchange of methionine for isoleucine at position 247 of CX50. PMID: 19756179

Show More

Hide All

Database Links

HGNC: 4281

OMIM: 116200

KEGG: hsa:2703

STRING: 9606.ENSP00000240986

UniGene: Hs.632441

Involvement In Disease
Cataract 1, multiple types (CTRCT1)
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Eye lens.

Q&A

What is Gap Junction Alpha-8 Protein and what is its primary function in human tissues?

Gap Junction Alpha-8 Protein (GJA8), also known as Connexin-50 or Lens fiber protein MP70, serves as a structural component of eye lens gap junctions. These gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells, formed by the docking of two hexameric hemichannels, one from each cell membrane. The primary function of GJA8 is to facilitate the diffusion of small molecules and ions from one cell to neighboring cells via the central pore of these channels. This intercellular communication is essential for maintaining lens transparency and proper lens development .

GJA8 is abundantly expressed in the lens and plays a critical role in lens growth and maturation of lens fiber cells. The protein's function is necessary for maintaining lens opacity and ensuring proper development of the eye .

How is GJA8 structurally organized, and what domains are critical for its function?

GJA8 contains four transmembrane domains, two extracellular loops, and cytoplasmic N-terminal and C-terminal regions. The first and second extracellular loops (EL1 and EL2) are particularly important for channel docking and formation of the complete gap junction. Mutations in these regions often lead to dysfunction of the protein.

Specifically, the first extracellular loop appears to be a crucial region for proper protein function, as evidenced by the pathogenic effect of mutations such as p.Thr56Ala, which is located in this region . The membrane topology of GJA8 demonstrates that these extracellular domains are essential for the hexameric assembly of connexins and the subsequent formation of functional gap junction channels.

What disorders are associated with GJA8 mutations in humans?

The most well-documented disorder associated with GJA8 mutations is congenital cataracts. Studies have consistently shown that mutations in the GJA8 gene are frequently linked to autosomal dominant congenital cataracts (ADCC) in humans. These cataracts are characterized by lens opacity that is present at birth or develops shortly thereafter .

Additionally, recent research has identified a potential role for GJA8 in other disorders. Notably, the GJA8 rs17160783 polymorphism has been associated with an increased risk of long-segment Hirschsprung's disease (L-HSCR) in the southern Chinese population. This finding suggests that GJA8 may play a role in the development of the enteric nervous system, potentially through the PI3K-Akt signaling pathway .

How do specific mutations in GJA8 affect protein function and lead to pathology?

Specific mutations in GJA8 can disrupt the formation or function of gap junctions in several ways. For example, the missense mutation c.166A>G (p.Thr56Ala), located in the first extracellular loop of GJA8, was identified in a family with autosomal dominant congenital cataract. This mutation affects a highly conserved threonine residue that is preserved across species and across different connexin family members .

Bioinformatics tools have predicted this mutation to be pathogenic, likely by altering the protein's ability to form proper channel structures or by affecting channel permeability. Such mutations can impair the intercellular communication necessary for lens transparency and development, leading to cataract formation.

Similarly, the rs17160783 polymorphism associated with L-HSCR may regulate GJA8 expression by altering the binding of transcription factors, subsequently impacting the PI3K-Akt signaling pathway during enteric nervous system development .

What animal models have been developed to study GJA8-related disorders?

Several animal models have been developed to study GJA8-related disorders, with the rabbit model being particularly noteworthy. Researchers have successfully created a cataract model with GJA8 gene knockout via co-injection of Cas9/sgRNA mRNA into rabbit zygotes. This model demonstrated an exceptionally high gene mutation efficiency, reaching 98.7% in embryos and 100% in pups .

The rabbit GJA8 knockout model recapitulates the phenotype of human congenital cataracts, exhibiting microphthalmia, small lens size, and cataracts. This model serves as an important tool for drug screening and for studying potential treatments for cataracts .

Mouse models have also been used to study GJA8 function, although the rabbit model may better represent human lens physiology and pathology in certain aspects.

How can CRISPR/Cas9 be optimized for GJA8 gene editing in different model systems?

The successful creation of GJA8 knockout rabbits demonstrates the efficacy of CRISPR/Cas9 for editing this gene. For optimal CRISPR/Cas9-mediated editing of GJA8, researchers should consider:

  • Careful sgRNA design targeting conserved and functionally significant regions of the gene

  • Appropriate delivery methods for the Cas9/sgRNA complex (e.g., co-injection into zygotes for germline editing)

  • Validation of editing efficiency using sequencing methods

The high mutation efficiency (98.7% in embryos and 100% in pups) achieved in the rabbit model indicates that CRISPR/Cas9 can be highly effective for GJA8 editing when properly optimized . This approach can be adapted for other animal models, considering species-specific factors that may affect editing efficiency.

What techniques are recommended for detecting GJA8 protein expression and localization in tissue samples?

For effective detection of GJA8 protein expression and localization, researchers should consider:

  • Immunohistochemistry or immunofluorescence with validated antibodies specific to GJA8/Connexin-50

  • Western blotting for quantitative assessment of protein levels

  • RT-PCR or qPCR for mRNA expression analysis

  • In situ hybridization to visualize mRNA localization in tissues

For mutation detection, sequencing methodologies as described in research studies include:

  • PCR amplification of target regions

  • Purification of PCR products using appropriate kits (e.g., QIAquick PCR purification kit)

  • Bidirectional sequencing with BigDye Terminator Cycle Sequencing Kit

  • Analysis using genetic analyzers (e.g., 3500xL Genetic Analyzer) and sequence assembly software

How should recombinant GJA8 be produced and purified for functional and structural studies?

Production of recombinant GJA8 presents challenges due to its transmembrane nature. Recommended approaches include:

  • Expression in mammalian cell systems rather than bacterial systems to ensure proper folding and post-translational modifications

  • Use of detergents or nanodiscs to stabilize the protein during purification

  • Affinity tags (e.g., His-tag, FLAG-tag) for purification, with careful consideration of tag placement to avoid disruption of protein function

  • Validation of protein structure and function using techniques such as circular dichroism, electrophysiology, or dye transfer assays

What evidence supports GJA8's role in non-ocular tissues and diseases?

While GJA8 is primarily studied in the context of lens development and cataracts, emerging evidence suggests roles in other tissues and diseases:

  • The association between GJA8 rs17160783 polymorphism and long-segment Hirschsprung's disease indicates a potential role in enteric nervous system development

  • This polymorphism may affect the PI3K-Akt signaling pathway, suggesting that GJA8 might participate in signaling cascades beyond its structural role in gap junctions

This emerging evidence opens new avenues for research into GJA8's functions beyond the lens, potentially in neuronal development and other tissue systems.

How do genetic variations in GJA8 affect molecular pathways across different tissue types?

The SNP rs17160783 in GJA8 may regulate gene expression by altering transcription factor binding, potentially impacting the PI3K-Akt signaling pathway during enteric nervous system development . This finding suggests that:

  • GJA8 may have tissue-specific regulatory mechanisms

  • Different mutations or polymorphisms may affect distinct molecular pathways

  • Gap junction proteins may contribute to cellular signaling beyond their structural role in forming intercellular channels

Understanding these tissue-specific effects requires comprehensive approaches including:

  • Tissue-specific gene expression studies

  • Functional assays in relevant cell types

  • Investigation of interacting proteins and signaling pathways in different tissues

How should researchers analyze the pathogenicity of novel GJA8 variants?

For analyzing the pathogenicity of novel GJA8 variants, researchers should employ:

  • Sequence analysis to identify conservation of affected amino acids across species and connexin family members

  • Bioinformatics prediction tools to assess potential functional impacts

  • Segregation analysis in families with suspected GJA8-related disorders

  • Functional studies in cellular or animal models

For example, the p.Thr56Ala mutation was determined to be pathogenic based on:

  • Its absence in 100 ethnically matched controls

  • Conservation of threonine at position 56 across species and different connexin proteins

  • Segregation with the cataract phenotype in affected family members

  • Bioinformatics predictions of pathogenicity

What are the current contradictions or knowledge gaps in understanding GJA8 function?

Current knowledge gaps and areas of contradiction in GJA8 research include:

  • The exact mechanisms by which different GJA8 mutations lead to cataracts (e.g., protein misfolding, altered channel permeability, disrupted protein interactions)

  • The full spectrum of GJA8's roles in non-lens tissues, particularly in the enteric nervous system and potentially other organs

  • The interaction between GJA8 and other connexin proteins in forming functional gap junctions

  • The regulatory mechanisms controlling GJA8 expression during development and in different tissues

  • The potential therapeutic approaches for modulating GJA8 function in disease states

Addressing these knowledge gaps requires interdisciplinary approaches combining genetics, cell biology, electrophysiology, and developmental biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.