Recombinant Human Gap junction beta-1 protein (GJB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery time details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Typically, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
GJB1; CX32; Gap junction beta-1 protein; Connexin-32; Cx32; GAP junction 28 kDa liver protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
GJB1
Target Protein Sequence
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCF VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
Uniprot No.

Target Background

Function
A gap junction consists of a cluster of closely packed pairs of transmembrane channels, known as connexons, through which low molecular weight materials diffuse from one cell to an adjacent cell.
Gene References Into Functions
  1. Mutations confined to the peripheral nervous system form gap junction plaques and exhibit junctional coupling comparable to wild-type Cx32. In contrast, mutants affecting the central nervous system either fail to form morphological gap junction plaques or, if they do, exhibit minimal or no detectable junctional coupling. PMID: 28071741
  2. Research indicates that the GJB1 (connexin 32; Cx32) mutants R75P, R75Q, and R75W display varying structural conformations and dynamic behavior compared to the native protein. PMID: 29111421
  3. Point mutations within the GJB1 gene, encoding connexin 32, are associated with X-linked Charcot-Marie-Tooth disease. PMID: 29710024
  4. Cx32 regulates the sensitivity of hepatocellular carcinoma cells to doxorubicin through the Src/FAK signaling pathway. PMID: 28968929
  5. Studies confirm that Cx32 exerts an inhibitory effect on extrinsic apoptosis in cervical cancer (CaCx) cells, suggesting that Cx32 may regulate the progression and microenvironment of CaCx cells. PMID: 28901517
  6. Cx32 is crucial for cell-cell interactions that facilitate the progression of human embryonic stem cells (hESCs) through hepatic-lineage maturation. PMID: 27874032
  7. Research provides a novel mechanism for Cx32's anti-apoptotic effect and offers a plausible explanation for the pro-tumor effect of Cx32 in human cervical cancer cells. PMID: 28902345
  8. Genetic analysis revealed 43 mutations, including 6 novel mutations. Ten mutations were identified from two or more unrelated families. p.V95M was observed most frequently. The prevalence of CMTX1 was 9.6% of the total Korean CMT family and 14.8% when calculated within genetically identified cases. PMID: 28448691
  9. PBX1 is one of the determinants in the Cx32 promoter targeting site, preventing further damage of the gap junction protein in H. pylori-associated gastric carcinogenesis. PMID: 28839434
  10. A study describes a novel mutation deleting the entire P2 promoter of the GJB1 gene in a single large family with X-linked Charcot-Marie-Tooth disease. Inheritance and phenotype of affected individuals displayed classical features of X-linked peripheral neuropathy. This study affirms the importance of the P2 promoter for Schwann cell function. PMID: 28601552
  11. Findings suggest that Cx32 inhibits Hepatocellular carcinoma (HCC) invasion and metastasis through Snail-mediated EMT, indicating that Cx32 and its associated signaling pathway molecules may offer potential targets for HCC cancer therapy. PMID: 28498415
  12. The study indicated that CNS impairment was not uncommon in Chinese CMT1X patients. Mutations in the EC2 domain of the GJB1 gene were hotspots in Chinese CMT1X patients. PMID: 28469099
  13. Abnormal Cx32 expression/localization in cervical cancer appears to be both a mechanism and biomarker of chemotherapeutic resistance. PMID: 28492539
  14. A study reports the mutation frequency of GJB1 in 210 Hungarian Charcot-Marie-Tooth neuropathy (CMT) patients and a phenotypic comparison between male and female CMT X type 1 patients. 13 missense substitutions were identified in GJB1, with pathogenic alterations primarily observed in males. Statistical analysis of CMT X type 1 patients revealed a significant difference between genders regarding age of onset, CMT, and examination scores. PMID: 27544631
  15. In conclusion, mutation screening should be prioritized in patients with intermediate Charcot-Marie-Tooth disease, particularly those exhibiting additional features. The novel GJB1 variants c.5A>G, c.8G>A, c.242T>C, and c.269T>C are considered pathogenic, while c.317T>C and c.434T>G are classified as probably pathogenic. PMID: 27804109
  16. Certain Golgi-retained Cx32 mutants may interfere with exogenously delivered Cx32. Screening for mutant-wild type Cx32 interactions should be considered before planning gene addition therapy for CMT1X. PMID: 28334782
  17. Distinct clinical/electrophysiological sex differences (both within and between families) were observed in patients with hereditary motor-sensory neuropathy 1X carrying the small es, Cyrillic.259C>G (small er, Cyrillic.P87A) mutation in the GJB1 gene. PMID: 28399101
  18. In summary, Cx32 is involved in cisplatin resistance, and cytoplasmic Cx32 plays a significant role in chemoresistance. PMID: 28412364
  19. Mutations in noncoding DNA of GJB1 are a major cause of CMTX1 and highlight the importance of mutations in noncoding DNA in human disease. PMID: 28283593
  20. NMR study of N-terminal mutants of Connexin 26 and Connexin 32 PMID: 27378082
  21. Knockdown of Cx32 by shRNA in HepG2 cells induced EMT, while overexpression of Cx32 converted EMT to mesenchymal-epithelial transition (MET) in the HepG2/DOX cells. These findings suggest that Cx32 is a key regulator of DOX-induced EMT in hepatocellular carcinoma. Cx32 could be considered as a novel target to reverse DOX resistance in hepatocellular carcinoma. PMID: 28260043
  22. The three novel missense mutations within the GJB1 gene expand the mutational diversity of X-linked Charcot-Marie-Tooth Disease type I (CMT1X). PMID: 27098783
  23. A novel point mutation in GJB1 was detected, expanding the spectrum of GJB1 mutations known to be associated with CMTX. PMID: 25595958
  24. Complete loss of connexin32 function is sufficient to induce central nervous system dysfunction with clinical manifestations. PMID: 25771809
  25. Transgenic expression of hCx32 in Cx32/Cx47dKO mice resulted in nearly complete rescue of behavioral abnormalities in a hypomyelinating leukodystrophy model. PMID: 25524707
  26. No mutations were found in GJB1 in a cohort of 38 Italian CMT2 patients. PMID: 24819634
  27. Findings suggest that the cytoplasmic tail of Cx32 may be involved in regulating the permeability of gap junctions by controlling their size. PMID: 25548281
  28. This study reported four novel mutations, c.191G > A, c.508G > T, c.778A > G, and c.300C > G of GJB1 in four Greek families with variable clinical features and mild clinical CNS manifestations in three of them. PMID: 24768312
  29. Mutations in the connexin 32 gene in patients with chronic rhinosinusitis, including recurrent acute rhinosinusitis, appear to be rare. PMID: 24119489
  30. The observation of two different mutations at the same nucleotide position within this Argentinean family represents a finding with a very low probability of occurrence. PMID: 23384994
  31. Segregation studies of GJB1 p.P58S with Sanger sequencing confirmed the presence of the variant in all affected individuals and one known carrier, and its absence in unaffected members. PMID: 23773993
  32. Endothelial Cx32 positively regulates angiogenesis by enhancing endothelial cell tube formation and cell migration. PMID: 24333598
  33. This study highlights the pathogenic role of GJB1 5' non-coding region mutations in CMT, suggesting that their identification should be considered for CMT patients lacking commonly observed mutations. PMID: 23827825
  34. This study demonstrates a mutation of CJB1 in a patient with Charcot-Marie-Tooth disease. PMID: 23743332
  35. This study demonstrates that GJB1 mutation is present in a patient with Charcot-Marie-Tooth disease in Spain. PMID: 24078732
  36. Collectively, these findings show that specific types of connexin channels are potential targets that can be exploited to enhance radiotherapeutic efficacy and to develop countermeasures against the detrimental effects of specific types of ionizing radiation. PMID: 23139176
  37. These results provide a novel docking mechanism for the gap junction channels of Cx32 and Cx26, and likely other compatible connexins. PMID: 23687377
  38. This study demonstrates that Connexin 32 is involved in mitosis and contributes to locomotor impairment. PMID: 22131286
  39. The antineoplastic effect of etoposide is reduced in Hela cells with decreased gap junction intercellular communication and is enhanced in cells with increased gap junction intercellular communication mediated by Cx26/Cx32. PMID: 22445976
  40. We report a novel connexin 32 (CX32) mutation associated with cognitive impairment and varying degrees of peripheral nerve involvement. PMID: 23279342
  41. Schwann cells and oligodendrocytes express Cx32, and the gap junctions formed by Cx32 play a crucial role in the homeostasis of myelinated axons--{REVIEW}. PMID: 22771394
  42. Five CX32 gene mutations were detected in 6 CMT families. Male patients tend to exhibit more severe clinical features, and their electrophysiological and pathological changes are intermediate. PMID: 22944031
  43. The positive charge at position 75 in Cx32 is required for normal channel function but not for gap junction assembly. PMID: 23209285
  44. Mutations in the GJB1 gene that cause hereditary motor-sensory neuropathy type 1 X are presented in this article. PMID: 23011429
  45. The frequency of mutations in the GJB1 gene in Charcot-Marie-Tooth type 1 patients in the Greek population (4.9%) was similar to frequencies reported in other ethnic populations. PMID: 22243284
  46. This study suggests differences between CMTX patients with Cx32 mutations and ethnic background. PMID: 21291455
  47. Two pathogenic mutations in the 5' regulatory sequence of the GJB1 gene (c.-529T>C and -459C>T) PMID: 21918739
  48. The influence of Cx32 and the homotypic gap junctional intercellular communication mediated by this Cx on the migration, invasion, and intercellular adhesion of transfected HeLa cells was investigated. PMID: 21687945
  49. Asn(175) of Cx32 is a critical residue for heterotypic docking and functional gap junction channel formation between the Cx32 and Cx26 hemichannels. PMID: 21478159
  50. We describe two families with X-linked inheritance and a phenotype consistent with CMT1X with upstream exon-splicing variant in the non-coding region of GJB1 PMID: 21504505

Show More

Hide All

Database Links

HGNC: 4283

OMIM: 145900

KEGG: hsa:2705

STRING: 9606.ENSP00000354900

UniGene: Hs.333303

Involvement In Disease
Charcot-Marie-Tooth disease, X-linked dominant, 1 (CMTX1); Dejerine-Sottas syndrome (DSS)
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Gap Junction Beta-1 Protein and what is its primary function?

Gap junction beta-1 protein (GJB1), also known as connexin 32 (Cx32), is a transmembrane protein encoded by the GJB1 gene in humans. It belongs to the gap junction protein family, which are membrane-spanning proteins that assemble to form gap junction channels. These channels facilitate the transfer of ions and small molecules between adjacent cells, enabling direct intercellular communication. Based on sequence similarities at both nucleotide and amino acid levels, gap junction proteins are categorized into two main groups: alpha and beta, with GJB1 belonging to the beta category .

The primary function of GJB1 is to establish communication pathways between cells, allowing for coordinated cellular responses and synchronized activity in tissues. This intercellular communication is essential for normal tissue homeostasis and proper physiological functioning. In tissues where GJB1 is predominantly expressed, such as the peripheral nervous system, liver, and other organs, these gap junctions play crucial roles in maintaining tissue integrity and function .

How is the GJB1 gene regulated at the transcriptional level?

The GJB1 gene has a complex transcriptional regulation system involving two tissue-specific promoters (P1 and P2) that generate different transcripts. These promoters allow for differential expression of GJB1 in neuronal and non-neuronal tissues. The P2 promoter specifically regulates GJB1 expression in neuronal tissues, while the P1 promoter is active in non-neuronal cells .

Though these two different transcripts include different 5′UTR regions, they ultimately provide mRNAs with identical coding regions, resulting in the same protein being produced. This dual promoter system enables precise control of GJB1 expression patterns across different tissue types. Recent research has highlighted that the noncoding region of GJB1 serves as a key regulator of protein expression, and mutations in this region are now recognized as a major cause of X-linked Charcot-Marie-Tooth disease, accounting for approximately 10% of patients with GJB1 mutations .

What are the common methods for detecting recombinant GJB1 protein in experimental systems?

Several established methods are available for detecting recombinant GJB1 protein in research settings:

  • Western Blot Analysis: This technique effectively detects GJB1 with antibody concentrations of 0.5-1ug/ml. The predicted molecular weight of GJB1 is approximately 32 kDa, providing a clear marker for identification. Western blotting can detect both native and phosphorylated forms of the protein, with different phosphorylation species often appearing as distinct bands .

  • Flow Cytometry: GJB1 can be detected in fixed and permeabilized cells using appropriate antibodies at concentrations of 1-3ug/million cells. This method is particularly useful for quantifying GJB1 expression at the single-cell level and for analyzing expression patterns in heterogeneous cell populations .

  • Direct ELISA: This method allows for quantitative detection of GJB1 using antibody concentrations of 0.1-0.5ug/ml. ELISA provides high sensitivity for protein detection and is valuable for measuring GJB1 levels in various sample types .

  • Immunocytochemistry/Immunofluorescence: These techniques enable visualization of GJB1 localization within cells, particularly at gap junctions. They can reveal the formation of gap junction plaques at cell-cell interfaces and detect abnormal intracellular aggregation in mutant forms .

How do mutations in the non-coding regions of GJB1 affect protein expression and function?

Recent research has revealed that mutations in the non-coding regions of GJB1, particularly in the 5′UTR, can have significant pathogenic effects by disrupting regulatory sequences. These mutations can affect GJB1 expression through several mechanisms:

  • Altered Splicing Patterns: Mutations in the 5′UTR can activate cryptic splice sites, leading to abnormal splicing of GJB1 mRNA. For example, the novel deletion mutation (NM_000166: c.-16-8_-14del) identified in a Chinese Han family with CMT disease was found to activate cryptic splicing sites in exon 2, resulting in the deletion of the first 256/278/545 nucleotides of exon 2. Similarly, a previously reported c.-16-3C>G substitution activated a cryptic splice site causing deletion of the first 278 nucleotides of exon 2 .

  • Intron Retention: Some mutations, such as c.-17+1G>T in the canonical splice site sequence, can cause retention of entire introns in the mRNA. This particular mutation resulted in the retention of intron 1 in the mRNA and demonstrated a 70% reduction in GJB1 transcript levels .

  • Impaired mRNA Translation and Stability: UTR variations may become pathogenic by disrupting sequences that regulate transcription or by impairing mRNA translation and stability, thus influencing protein expression levels .

The identification of these non-coding region mutations has expanded our understanding of GJB1-related pathologies and highlighted the importance of examining the entire gene, including regulatory regions, when screening for disease-causing mutations in patients with suspected GJB1-related disorders.

What are the mechanisms by which mutant GJB1 proteins cause cellular dysfunction?

Mutant GJB1 proteins can cause cellular dysfunction through several mechanisms:

  • Protein Aggregation: Mutant forms of GJB1 show a higher propensity to aggregate compared to wild-type. Detergent-based sequential fractionation studies have confirmed that mutants (p.F31S, p.W44G, p.Y157H, and p.R220Pfs23) are higher expressed and more prone to aggregate than wild-type GJB1. Among these, the frameshift mutant R220Pfs23 shows the greatest amount of SDS-soluble multimers and monomers .

  • Subcellular Mislocalization: Intracellular aggregation of mutant GJB1 proteins predominantly occurs in the endoplasmic reticulum compartment rather than the Golgi apparatus. This mislocalization can disrupt normal protein trafficking and cellular homeostasis .

  • Compromised Gap Junction Formation: Some mutations, particularly frameshift mutations like R220Pfs*23, compromise the formation of gap junction plaques at cell-cell interfaces. This disruption of gap junction formation directly impairs intercellular communication .

  • Stress Granule Formation: Mutated GJB1 induces significant intracellular stress granule formation, which is a cellular response to environmental stress that can alter normal protein synthesis and cellular function .

  • Cytotoxicity: The aggregation of mutant GJB1 proteins can impair cell viability, indicating cytotoxicity of these self-aggregates. This cytotoxicity likely contributes to the progressive neurodegeneration observed in conditions like CMT1X .

These findings provide insights into the pathomechanisms of GJB1-related disorders and suggest potential therapeutic targets aimed at reducing protein aggregation or mitigating cellular stress responses.

How does TGF-beta1 signaling interact with GJB1/connexin expression and function?

While the search results primarily discuss TGF-beta1's effects on Connexin 43 (Cx43) rather than GJB1/Cx32 directly, the findings provide valuable insights into potential regulatory mechanisms for connexin family proteins:

  • Downregulation of Connexin Expression: In human detrusor smooth muscle cells (hBSMCs), TGF-beta1 stimulation leads to significant downregulation of Cx43 protein expression. After TGF-beta1 treatment, Cx43 mRNA levels were reduced to approximately 30% of control levels. This suggests that TGF-beta1 can negatively regulate connexin gene expression at the transcriptional level .

  • Differential Effect on Phosphorylation: Interestingly, TGF-beta1 treatment particularly affects low phosphorylation species of Cx43. This selective effect on specific phosphorylation states may indicate a regulatory mechanism that affects connexin protein stability or function .

  • Reduced Functional Coupling: TGF-beta1 treatment leads to significant reduction of connexin immunoreactivity and intercellular coupling. Dye-coupling experiments revealed that functional syncytia formation was impaired following TGF-beta1 stimulation, indicating reduced gap junctional communication .

  • Pathophysiological Implications: The downregulation of connexin expression by TGF-beta1 has been implicated in the pathophysiology of urinary bladder dysfunction, suggesting a broader role for TGF-beta1-mediated connexin regulation in various physiological and pathological conditions .

While these findings specifically relate to Cx43, similar regulatory mechanisms might apply to GJB1/Cx32, given the structural and functional similarities within the connexin family. Researchers investigating GJB1 should consider examining TGF-beta1 signaling effects on GJB1 expression and function, particularly in pathological conditions where both factors may play a role.

What are the optimal conditions for expressing recombinant human GJB1 in cell culture systems?

Based on the available search results, the following methodological approaches are recommended for optimal expression of recombinant human GJB1 in cell culture systems:

  • Expression Vector Construction: For efficient expression, GJB1 can be cloned into expression vectors with strong promoters (such as CMV) and appropriate tags (such as FLAG) for detection and purification. The FLAG tag appears to be compatible with GJB1 expression and detection while allowing for protein function studies .

  • Cell Line Selection: Multiple cell lines have been successfully used for GJB1 expression studies, including HEK293 cells for protein expression analysis and HepG2 cells for functional studies. The choice of cell line should be based on the specific research question, with consideration of endogenous connexin expression that might complicate interpretation of results .

  • Transfection Timing: When expressing GJB1, it's important to consider the time course of expression. Researchers have observed protein aggregation at various time points after transfection with both wild-type and mutant forms of GJB1. This time-dependent behavior should be monitored when designing experiments, particularly those focused on protein localization or function .

  • Detection Methods: For detection of expressed GJB1, Western blotting can be performed using 0.5-1 μg/ml of specific antibodies. Flow cytometry is effective using 1-3 μg/million cells, while direct ELISA can be performed with 0.1-0.5 μg/ml of antibody. Immunofluorescence can be used to visualize GJB1 localization, particularly at gap junctions .

  • Analysis of Aggregation: For studies focused on protein aggregation, detergent-based sequential fractionation can be employed to distinguish between soluble protein and aggregates. This approach has been used to compare aggregation propensities between wild-type and mutant GJB1 proteins .

What techniques are most effective for studying the functional consequences of GJB1 mutations?

Several complementary techniques have proven effective for investigating the functional consequences of GJB1 mutations:

  • Whole Exome Sequencing and Variant Validation: For identifying novel GJB1 mutations, whole exome sequencing with adequate coverage (e.g., 97.3% of target bases covered with at least 20× per individual) followed by validation with Sanger sequencing provides a reliable approach. This method has successfully identified both novel and previously reported GJB1 variants .

  • Minigene Splicing Assay: This technique is particularly valuable for investigating mutations that may affect mRNA splicing. In cell-based systems such as HEK293 or MCF-7 cells, minigene constructs containing wild-type or mutant sequences can be expressed to analyze splicing patterns. This approach has verified that certain 5′UTR mutations lead to activation of cryptic splicing sites and abnormal mRNA processing .

  • SNP Array Linkage Analysis: For familial studies, NGS-based SNP haplotyping can confirm the association between identified mutations and disease phenotypes. This approach has been used to upgrade mutation pathogenicity classification from "Uncertain Significance" to "Pathogenic" by demonstrating co-segregation with disease .

  • Cellular Localization Studies: Immunocytochemistry and confocal microscopy can reveal the subcellular localization of wild-type and mutant GJB1 proteins. These techniques have shown that mutant GJB1 proteins may aggregate in the endoplasmic reticulum and form stress granules, rather than properly localizing to the cell membrane to form gap junctions .

  • Cell Viability and Stress Response Assays: Assays measuring cell viability and stress granule formation provide insights into the cytotoxicity of mutant GJB1 proteins. These functional readouts help connect molecular abnormalities to cellular dysfunction .

  • Dye-Coupling Experiments: These experiments assess the formation of functional syncytia and intercellular communication. By injecting fluorescent dyes into cells and monitoring their spread to adjacent cells, researchers can evaluate gap junction functionality. This approach has demonstrated that certain treatments (e.g., TGF-beta1) can significantly reduce coupling between cells .

How can researchers quantitatively assess gap junction functionality in cells expressing wild-type versus mutant GJB1?

Researchers can employ several quantitative methods to assess gap junction functionality when comparing wild-type and mutant GJB1:

  • Dye-Coupling Experiments: This technique directly measures functional gap junctional communication by injecting fluorescent dyes into cells and monitoring their spread to adjacent cells. The size of functional syncytia (groups of interconnected cells) can be measured by counting the number of cells receiving the dye. This method has been used to demonstrate stable formation of functional syncytia in passaged cell cultures and to show reduction in coupling following various treatments .

  • Immunocytochemistry Quantification: Gap junction plaque formation at cell-cell interfaces can be visualized and quantified using immunofluorescence microscopy. The number, size, and intensity of gap junction plaques can be measured to compare wild-type and mutant GJB1. Research has shown that gap junction plaques may be present in cells expressing various GJB1 mutants but are often compromised in frameshift mutants .

  • Detergent-Based Sequential Fractionation: This biochemical approach can quantitatively assess the aggregation propensity of wild-type versus mutant GJB1 proteins. The technique separates proteins based on their solubility in different detergents, allowing for quantification of properly folded proteins versus aggregates. Studies have confirmed that mutant forms of GJB1 show higher expression levels and greater aggregation propensity compared to wild-type .

  • Electrophysiological Recordings: While not explicitly mentioned in the search results, patch-clamp techniques can provide direct functional measurements of gap junction channel conductance and are widely used in connexin research. These electrophysiological approaches offer quantitative data on channel opening, conductance, and regulation.

  • Stress Granule Quantification: The formation of intracellular stress granules induced by mutated GJB1 can be quantified as an indirect measure of cellular dysfunction. The number and size of stress granules per cell can be compared between wild-type and mutant GJB1-expressing cells .

  • Cell Viability Assays: Quantitative assessment of cell viability can indicate the cytotoxicity of GJB1 aggregates. Reduced viability in cells expressing mutant GJB1 compared to wild-type provides a functional readout of the pathogenic effects of the mutations .

What are the characteristic clinical and electrophysiological features of GJB1-related Charcot-Marie-Tooth disease?

GJB1-related Charcot-Marie-Tooth disease, also known as CMTX1, presents with distinctive clinical and electrophysiological features:

  • Clinical Manifestations:

    • Symmetric atrophy and progressive weakness of the distal muscles, typically beginning in the twenties

    • Slowly progressive, axonal defective neuropathy

    • In some cases, additional neurologic manifestations in the central nervous system

    • Adult-onset in many cases, with slow progression over time

  • Electrophysiological Features:

    • Peripheral nerve injury of both upper and lower limbs

    • Evidence of both demyelination and axonal degeneration

    • Reduced nerve conduction velocities

    • These electrophysiological abnormalities typically correlate with clinical symptoms and can be used for diagnosis and monitoring disease progression

  • Genetic Characteristics:

    • X-linked inheritance pattern

    • GJB1 mutations account for approximately 10% of all CMT cases worldwide

    • Second most frequent cause of CMT after PMP22 duplication

    • Over 450 disease-causing mutations recorded in the HGMD database, with most being missense mutations in the coding region

    • Recent recognition that mutations in non-coding regions (particularly 5′UTR) account for about 10% of GJB1 mutation cases

  • Variable Expressivity:

    • Symptoms typically appear in the twenties but can vary in onset and severity

    • Some mutations are associated with additional central nervous system manifestations

    • The R220Pfs*23 frameshift mutation carrier exhibited both peripheral neuropathy and CNS involvement

Understanding these characteristics is essential for diagnosis, genetic counseling, and developing targeted therapies for GJB1-related CMT disease.

How can functional studies of GJB1 mutations inform genetic counseling and therapeutic development?

Functional studies of GJB1 mutations provide critical insights that directly impact genetic counseling and therapeutic approaches:

  • Refinement of Variant Classification:

    • Functional studies can upgrade the pathogenicity classification of variants from "Uncertain Significance" to "Pathogenic" according to ACMG criteria

    • For example, the novel deletion mutation (c.-16-8_-14del) was initially classified as "Uncertain Significance" but was upgraded to "Pathogenic" after linkage analysis, co-segregation studies, and minigene splicing assays confirmed its functional impact

    • This reclassification provides greater certainty for genetic counseling and clinical decision-making

  • Prenatal Diagnosis Guidance:

    • Functional validation of pathogenic mutations provides theoretical guidance for prenatal diagnosis

    • For families with established pathogenic mutations, this information facilitates family planning decisions and subsequent fertility counseling

    • As noted in the case of the Chinese Han family with the novel 5′UTR deletion, functional studies provided crucial guidance for prenatal diagnosis

  • Mechanism-Based Therapeutic Targets:

    • Understanding the cellular mechanisms of GJB1 mutations reveals potential therapeutic targets

    • For mutations causing protein aggregation in the endoplasmic reticulum, therapies targeting protein folding or degradation pathways might be beneficial

    • For mutations inducing stress granule formation, approaches to mitigate cellular stress responses could be explored

    • The demonstration that mutant GJB1 causes cytotoxicity through self-aggregates suggests that preventing aggregation could be a therapeutic strategy

  • Personalized Medicine Approaches:

    • Different mutations cause dysfunction through distinct mechanisms, suggesting that therapeutic approaches may need to be tailored to specific mutation types

    • For example, splicing mutations might be addressed with splice-modulating therapies, while mutations causing protein aggregation might benefit from chemical chaperones or autophagy enhancers

    • This mechanistic understanding enables more personalized therapeutic development

  • Expansion of Testing Strategies:

    • Functional studies highlighting the importance of non-coding mutations have expanded testing strategies

    • For patients with clinical CMT in whom Sanger sequencing of the coding region is negative, further screening of the 5′ and 3′UTR regions is now recommended

    • This expanded testing approach increases diagnostic yield and provides more comprehensive genetic counseling

What are the molecular pathways linking GJB1 mutations to neurodegeneration in Charcot-Marie-Tooth disease?

The search results reveal several molecular pathways connecting GJB1 mutations to neurodegeneration in Charcot-Marie-Tooth disease:

  • Disrupted Intercellular Communication:

    • GJB1 encodes connexin 32, which forms gap junction channels essential for cell-to-cell communication

    • Mutations that compromise gap junction plaque formation, as seen with the R220Pfs*23 frameshift mutation, directly impair intercellular communication

    • This disruption likely affects the coordinated function of Schwann cells and neurons in peripheral nerves, leading to progressive neuropathy

  • Protein Aggregation and ER Stress:

    • Mutant GJB1 proteins show higher propensity to aggregate than wild-type

    • Intracellular aggregation predominantly occurs in the endoplasmic reticulum compartment

    • This aggregation can trigger ER stress responses and the unfolded protein response, potentially leading to cellular dysfunction and ultimately cell death

    • All studied mutants (p.F31S, p.W44G, p.Y157H, and p.R220Pfs*23) showed increased aggregation propensity compared to wild-type GJB1

  • Stress Granule Formation:

    • Mutated GJB1 induces significant intracellular stress granule formation

    • Stress granules are cytoplasmic aggregates of proteins and RNAs that form in response to cellular stress

    • Their formation can disrupt normal protein synthesis and cellular metabolism

    • Persistent stress granule formation may contribute to long-term cellular dysfunction and neurodegeneration

  • Cytotoxicity and Cell Viability Impairment:

    • GJB1 mutants demonstrated impaired cell viability, indicating cytotoxicity of self-aggregates

    • This direct cytotoxic effect provides a mechanistic link between protein aggregation and cell death

    • Progressive loss of Schwann cells or neurons due to this cytotoxicity would explain the slowly progressive nature of CMT1X

  • Abnormal mRNA Processing:

    • Mutations in non-coding regions, particularly the 5′UTR, can disrupt normal mRNA splicing

    • This can lead to abnormal transcripts with altered protein expression or function

    • For example, the c.-16-8_-14del mutation activates cryptic splicing sites, resulting in deletion of portions of exon 2

    • These alterations in gene expression contribute to the pathogenesis of CMT1X

Understanding these molecular pathways provides valuable insights for therapeutic targeting. Potential approaches might include reducing protein aggregation, mitigating ER stress, modulating stress granule formation, or correcting abnormal mRNA processing through gene therapy or splice-modulating compounds.

What are promising approaches for developing therapies targeting GJB1-related disorders?

Based on our current understanding of GJB1 pathophysiology, several promising therapeutic approaches emerge:

Each of these approaches warrants further investigation in appropriate cellular and animal models of GJB1-related disorders before advancing to clinical studies.

How might high-throughput screening methodologies be applied to identify compounds that rescue GJB1 mutation phenotypes?

High-throughput screening (HTS) methodologies offer powerful approaches for identifying therapeutic compounds for GJB1-related disorders:

  • Cell-Based Phenotypic Screens: Cells expressing mutant GJB1 could be used in phenotypic screens to identify compounds that:

    • Reduce protein aggregation in the endoplasmic reticulum

    • Restore proper trafficking of GJB1 to the cell membrane

    • Enhance formation of gap junction plaques

    • Reduce stress granule formation

    • Improve cell viability

    These endpoints could be monitored using fluorescently tagged GJB1, stress granule markers, or viability assays in a multi-well format suitable for automated screening .

  • Splicing Reporter Assays: For mutations affecting mRNA splicing, minigene constructs containing wild-type or mutant sequences fused to reporter genes could be used to screen for compounds that correct splicing defects. This approach would be particularly relevant for the 5′UTR mutations that activate cryptic splice sites .

  • Gap Junction Functionality Screens: Dye transfer assays measuring intercellular communication could be adapted for high-throughput format to identify compounds that restore functional coupling between cells expressing mutant GJB1. Fluorescent dye transfer between adjacent cells could be quantified using automated imaging systems .

  • Protein-Protein Interaction Screens: Since proper assembly of connexins into hexameric hemichannels and gap junction plaques involves specific protein-protein interactions, assays that monitor these interactions (such as split-luciferase complementation) could be used to screen for compounds that promote proper assembly of mutant GJB1.

  • ER Stress Response Screens: Reporter systems monitoring ER stress pathway activation (such as XBP1 splicing or CHOP induction) could identify compounds that mitigate the ER stress caused by mutant GJB1 aggregation. Reducing ER stress might prevent downstream cell death even if protein aggregation persists .

  • Patient-Derived Cell Models: iPSC-derived Schwann cells or neurons from patients with GJB1 mutations would provide physiologically relevant screening platforms that capture patient-specific disease mechanisms. These models would be particularly valuable for secondary validation of hits from primary screens.

  • In Silico Screening Approaches: Computational methods could be employed to identify compounds likely to interact with specific regions of GJB1 or with proteins involved in its folding, trafficking, or degradation. These in silico approaches could prioritize compounds for experimental testing, increasing the efficiency of the drug discovery process.

The combination of these diverse screening approaches would maximize the chance of identifying effective therapeutics targeting different aspects of GJB1-related pathophysiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.