Recombinant Human Gap junction beta-3 protein (GJB3)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Characteristics

Recombinant GJB3 is synthesized using heterologous expression systems, primarily HEK293 cells or E. coli, to ensure high yield and purity. Key features include:

ParameterHEK293 Expression (Source 9)E. coli Expression (Source 11)
Expression SystemHuman embryonic kidney cellsProkaryotic system
TagMyc/DDK (C-terminal)His/GST
Purity>95%>95%
ApplicationsELISA, Western blot (WB), IPWB, SDS-PAGE
Storage-80°C (long-term), 2–8°C (short)-80°C
Concentration1 mg/ml (RIPA buffer)Lyophilized (reconstitute in PBS)

HEK293-derived GJB3 lysates are often used as antigen standards, while E. coli-produced proteins are utilized for structural studies and antibody validation .

Functional Roles and Mechanisms

GJB3’s primary function is to form gap junctions, but its recombinant form has been studied for its role in pathological processes:

2.1. Role in Cancer Metastasis

In pancreatic ductal adenocarcinoma (PDAC), GJB3 promotes liver metastasis by:

  1. Enhancing Neutrophil Survival and Polarization: GJB3 forms channels between cancer cells and neutrophils, transferring cyclic adenosine monophosphate (cAMP). This cAMP influx polarizes neutrophils toward an immunosuppressive N2 phenotype, enabling immune evasion .

  2. Regulating Metabolic Shifts: GJB3 knockdown in PDAC cells reduces neutrophil oxidative phosphorylation and increases glycolysis, impairing their survival .

ProcessGJB3 RoleExperimental Evidence
cAMP TransferChannels facilitate cAMP flow to neutrophilsReduced extracellular cAMP in GJB3-depleted cells
Metabolic ReprogrammingDisrupts neutrophil energy metabolismAltered oxygen consumption and glycolysis rates

2.2. Diagnostic and Therapeutic Potential

GJB3 has emerged as a biomarker for:

  • Pancreatic Adenocarcinoma (PAAD): High GJB3 expression correlates with poor prognosis and liver metastasis .

  • Immune Checkpoint Therapy: GJB3 co-expresses with immune checkpoint genes, suggesting its role in modulating immunotherapy efficacy .

3.1. Mechanistic Insights

  • ER Stress and Skin Disorders: Mutations in GJB3 cause erythrokeratodermia variabilis (EKVP), where misfolded proteins accumulate in the endoplasmic reticulum, triggering cell death .

  • Hearing Loss: GJB3 mutations disrupt inner ear function, leading to non-syndromic deafness .

3.2. Antibody Validation and Assay Applications

Recombinant GJB3 is critical for developing specific antibodies. For example:

  • Monoclonal Antibodies: Clone 3B4-1B3 (Source 10) detects GJB3 in transfected HEK293 lysates and HeLa cells via WB and immunofluorescence.

  • Polyclonal Antibodies: Rabbit-derived antibodies (Source 6) validate GJB3 expression in human, mouse, and rat tissues.

Challenges and Future Directions

  • Production Limitations: E. coli-derived GJB3 lacks post-translational modifications, limiting functional studies. HEK293 systems better mimic native protein processing but require specialized equipment .

  • Therapeutic Targeting: Inhibiting GJB3-cAMP transfer pathways could suppress metastasis. Small-molecule inhibitors or RNAi strategies are under exploration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GJB3; CX31; Gap junction beta-3 protein; Connexin-31; Cx31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
GJB3
Target Protein Sequence
MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGC TNVCYDNYFPISNIRLWALQLIFVTCPSLLVILHVAYREERERRHRQKHGDQCAKLYDNA GKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIAR PTEKKIFTYFMVGASAVCIVLTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCR CHHKLVEAGEVDPDPGNNKLQASAPNLTPI
Uniprot No.

Target Background

Function
Gap junctions are composed of connexons, closely packed transmembrane channel pairs that facilitate the diffusion of low-molecular-weight materials between adjacent cells.
Gene References Into Functions

Relevant Research on GJB3 and Associated Conditions:

  1. GJB3 mutations contribute to a small percentage of hearing loss cases in individuals with double heterozygous states involving autosomal recessive GJB2 mutations. PMID: 29926981
  2. The GJB3 c.538C>T variant is not associated with hearing loss, providing valuable information for genetic counseling and deafness risk prediction. PMID: 29106878
  3. Combined heterozygous mutations in SLC26A4 and GJB3 genes can lead to severe hearing loss, furthering our understanding of the clinical phenotypes in patients carrying these combined mutations. PMID: 27176802
  4. Studies suggest that misfolded Connexin-31 (Cx31) mutant proteins contribute to erythrokeratodermia variabilis, potentially through an AP-1-mediated mechanism, and highlight a potential therapeutic small molecule. PMID: 26251042
  5. A dominant pathogenic missense mutation in the M4 transmembrane domain of GJB3 has been identified, associated with the erythrokeratodermia variabilis (EKV) phenotype. This, along with literature review, suggests that dominant missense mutations outside the E2 domain are associated with EKV, while those within the E2 domain are linked to autosomal dominant nonsyndromic hearing loss (ADNSHL). PMID: 25556823
  6. The Cx31 V174M mutant may affect gap junction formation and function in nonsyndromic hearing loss. PMID: 24913888
  7. No GJB3 mutations were identified in two families with progressive symmetrical erythrokeratodermia. PMID: 23678955
  8. Mutations in GJB3 are prevalent in hearing loss patients. PMID: 23638949
  9. A missense mutation p.G45E in the GJB3 gene was identified as the cause of Erythrokeratodermia variabilis in a Chinese family. PMID: 22681493
  10. GJB3 and GJB6 genetic variants are associated with nonsyndromic sensorineural hearing loss. PMID: 22617145
  11. Mutation analysis of GJB3 and GJB4 was conducted in Chinese patients with erythrokeratodermia variabilis. PMID: 21950330
  12. Pathogenic connexin-31 forms constitutively active hemichannels, contributing to necrotic cell death. PMID: 22393412
  13. A neonatal hearing screening program in Campania, Italy, did not detect any GJB6 or GJB3 mutations. PMID: 21916817
  14. GJB3 gene mutations are not the primary cause of hereditary nonsyndromic hearing loss in Uighur and Han populations. PMID: 21055240
  15. No mutations were found in the GJB3 gene in a study of progressive symmetrical erythrokeratodermia, leaving the pathogenesis unresolved. PMID: 21198793
  16. Endoplasmic reticulum stress, leading to the unfolded protein response, is a key mechanism in Cx31 mutant-associated cell death. PMID: 19755382
  17. A homozygous mutation in the connexin 31 gene was identified in a family with recessive erythrokeratodermia variabilis, offering molecular support for a recessive variant of the disorder. PMID: 12019212
  18. Connexin 31 mutations are linked to defective trafficking and cell death in skin diseases. PMID: 12165562
  19. Expression of a connexin31 mutation causing erythrokeratodermia variabilis is lethal to HeLa cells. PMID: 12176042
  20. Pathogenic CX31 mutations are uncommon in sporadic non-syndromic hearing impairment. PMID: 12630965
  21. Research examined the effects of sequence variants G12D and R32W on Cx31 biogenesis and gap junction activity. PMID: 12702148
  22. Studies provide insights into epidermal connexin synthesis and polymerization, explaining the similar EKV phenotypes. PMID: 14583444
  23. Disease-associated Cx31 mutants impair gap junction formation at various stages. PMID: 16077902
  24. Not all individuals clinically diagnosed with erythrokeratodermia variabilis possess Cx31 disease-associated mutations. PMID: 16297190
  25. Studies provide a crucial initial step in understanding the pathogenesis of inherited human diseases linked to Cx31 gene mutations. PMID: 16549784
Database Links

HGNC: 4285

OMIM: 133200

KEGG: hsa:2707

STRING: 9606.ENSP00000362460

UniGene: Hs.522561

Involvement In Disease
Erythrokeratodermia variabilis et progressiva 1 (EKVP1); Deafness, autosomal dominant, 2B (DFNA2B)
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

Basic Research Questions

  • What is the biological function of GJB3 in normal tissues?

    GJB3 belongs to the connexin family of proteins that assemble into hexameric structures called connexons. These structures form channels between adjacent cells, allowing the transfer of small molecules, metabolites, and secondary messengers like cyclic adenosine monophosphate (cAMP) . In normal tissue physiology, GJB3 facilitates direct intercellular communication, which is essential for coordinated cellular responses and tissue homeostasis. Unlike some other connexins, GJB3 shows tissue-specific expression patterns and may form both homotypic and heterotypic channels with other connexin family members.

  • What are the standard methods for detecting GJB3 expression in tissue samples?

    Several complementary approaches are recommended for comprehensive GJB3 detection:

    • Protein detection: Western blotting using validated anti-GJB3 antibodies, with GAPDH as an internal control

    • mRNA quantification: Quantitative real-time PCR (qRT-PCR) and semi-quantitative PCR, with TPT1 often used as a control gene

    • Localization studies: Immunohistochemistry and immunofluorescence to visualize GJB3 expression patterns and co-localization with other connexins

    • High-throughput analysis: RNA sequencing for transcriptome-wide expression analysis

    When examining GJB3 in disease contexts, it's important to analyze both the protein and mRNA levels, as post-transcriptional regulation can affect expression.

  • How is GJB3 expression regulated at the genetic and epigenetic levels?

    GJB3 expression is regulated through multiple mechanisms:

    • Epigenetic regulation: GJB3 expression can be induced by treatment with deoxy-azacytidine (DAC), a DNA methyltransferase inhibitor, suggesting promoter methylation plays a significant role in silencing GJB3 expression

    • Copy number variations: Unlike some other connexin genes, GJB3 expression doesn't strongly correlate with copy number variations in cancer samples

    • Transcriptional regulation: Multiple transcription factors may bind to the GJB3 promoter region, though specific regulators require further characterization

    • Post-transcriptional control: miRNAs may target GJB3 mRNA, providing another layer of expression control

    Understanding these regulatory mechanisms is crucial when designing experiments to manipulate GJB3 expression.

  • What cellular signaling pathways interact with GJB3?

    GJB3 interacts with several important cellular signaling networks:

    • Stress response pathways: GJB3 knockdown activates the eIF2α/ATF4 pathway, indicating a role in cellular stress responses

    • Autophagy pathways: GJB3 inhibition triggers autophagy activation, suggesting a connection between gap junction communication and cellular recycling processes

    • Apoptotic signaling: GJB3 depletion can promote apoptosis through caspase-3 activation

    • Metabolic pathways: GJB3 appears to support cystine uptake, affecting cellular metabolism

    These interactions highlight GJB3's multifaceted role beyond simple intercellular communication.

  • How does GJB3 compare structurally and functionally to other connexin family members?

    GJB3 shares the characteristic four-transmembrane domain structure of connexin family proteins but differs in several aspects:

    • Channel properties: GJB3 forms channels with distinct permeability and selectivity compared to other connexins

    • Tissue distribution: While GJA1 (Connexin 43) is widely expressed, GJB3 shows more restricted expression patterns

    • Disease associations: Unlike GJB4, which is implicated in cardiac function , GJB3 has stronger associations with cancer progression and metastasis

    • Regulatory mechanisms: Each connexin family member responds differently to regulatory signals, contributing to tissue-specific gap junction communication

    When designing studies, researchers should consider these differences and avoid generalizing findings from one connexin to another.

Advanced Research Questions

  • What is the role of GJB3 in cancer metastasis, particularly in pancreatic cancer?

    GJB3 has been identified as a critical promoter of pancreatic ductal adenocarcinoma (PDAC) liver metastasis:

    • Expression correlation: GJB3 expression is significantly increased in PDAC liver metastasis compared to primary tumors

    • Functional evidence: Animal experiments confirm that GJB3 depletion suppresses hepatic metastasis of PDAC cancer cells

    • Mechanistic insight: GJB3 does not directly affect cancer cell proliferation but instead modifies the tumor microenvironment by:

      • Forming channels between PDAC cells and neutrophils

      • Transferring cAMP from cancer cells to neutrophils

      • Supporting neutrophil survival and polarization toward an immunosuppressive phenotype

    These findings suggest GJB3 could be a promising therapeutic target specifically for preventing or treating PDAC liver metastasis.

  • How does GJB3 influence the tumor immune microenvironment?

    GJB3 significantly shapes the immune landscape in tumors, particularly through its effects on neutrophils:

    • Neutrophil recruitment: Flow cytometry analysis of liver metastasis tissues showed that GJB3 expression correlates with increased neutrophil infiltration

    • Polarization effects: GJB3 promotes polarization toward the immunosuppressive N2 phenotype, with:

      • Decreased expression of N1-related genes (Cd95, Nos2, Ccl3) in neutrophils co-cultured with GJB3-expressing cancer cells

      • Increased expression of N2-related genes (Cd206, Arg2, Ccl2) facilitated by GJB3

    • Metabolic reprogramming: GJB3 shifts neutrophil metabolism from glycolysis to mitochondrial oxidative phosphorylation, supporting their immunosuppressive function

    • Survival promotion: GJB3 enhances neutrophil survival by reducing FasL expression and inhibiting apoptosis

    These effects collectively create a more permissive environment for cancer progression and metastasis.

  • What metabolic pathways are affected by GJB3 expression or inhibition?

    GJB3 influences several key metabolic pathways:

    PathwayEffect of GJB3 KnockdownPotential Mechanism
    Amino acid transportUpregulation of amino acid transport genesResponse to metabolic stress
    GlycolysisEnhanced glycolytic activity in neutrophilsMetabolic reprogramming
    Oxidative phosphorylationReduced oxygen consumption rateShift in energy metabolism
    Cystine uptakeImpaired cystine uptakeModulation of SLC7A11-independent pathways
    AutophagyIncreased autophagy activationCellular stress response

    These metabolic effects may explain why GJB3 inhibition creates cellular stress conditions that trigger compensatory pathways like autophagy and stress response signaling.

  • What are the methodological considerations for studying GJB3-mediated intercellular communication?

    Investigating GJB3-mediated communication presents several technical challenges:

    • Gap junction specificity: Use paired cell systems with selective expression of GJB3 to distinguish its effects from other connexins

    • Dye transfer assays: Employ gap junction-permeable dyes (e.g., Lucifer yellow) while considering:

      • Appropriate dye size selection based on GJB3 channel permeability

      • Careful control experiments with gap junction inhibitors

      • Analysis of transfer kinetics for quantitative assessment

    • Metabolite tracking: For studying cAMP transfer:

      • Use fluorescent cAMP analogs or FRET-based sensors

      • Combined with GJB3 mutants defective in channel formation

      • Include parachute assays to confirm direct cellular coupling

    • Co-culture systems: When examining GJB3-mediated interactions between different cell types (e.g., cancer cells and neutrophils):

      • Establish reliable cell separation techniques post-co-culture

      • Implement transwell systems as controls for non-contact-dependent effects

      • Consider microfluidic approaches for precise cellular positioning

    These considerations help ensure that observed effects are specifically attributable to GJB3-mediated communication.

  • How does GJB3 knockdown affect cellular stress response pathways?

    GJB3 depletion triggers a coordinated cellular stress response:

    • Transcriptional changes: RNA sequencing reveals 475 upregulated and 801 downregulated genes following GJB3 knockdown

    • Stress pathway activation: Increased phosphorylation of eIF2α and elevated ATF4 levels indicate activation of the integrated stress response

    • Sensor involvement: GJB3 knockdown potentially activates GCN2 and PERK stress sensors, which respectively sense amino acid starvation and ER stress

    • Functional consequences: The stress response leads to:

      • Induction of autophagy as a survival mechanism

      • Enhanced apoptosis sensitivity

      • Inhibition of growth-related pathways

    These findings suggest GJB3 normally functions to maintain cellular homeostasis, and its loss triggers adaptive stress responses.

  • What is the correlation between GJB3 expression and patient outcomes in different cancers?

    GJB3 expression has significant prognostic implications:

    • Lung adenocarcinoma: Higher GJB3 expression correlates with poorer survival outcomes, as demonstrated by Kaplan-Meier analyses of TCGA data

    • Colorectal cancer: Similar negative correlation between GJB3 expression and patient survival

    • Pancreatic cancer: GJB3 expression is associated with PDAC poor prognosis, particularly in the context of liver metastasis

    These correlations suggest GJB3 may serve as a potential prognostic biomarker across multiple adenocarcinomas.

  • What approaches can be used to therapeutically target GJB3 in cancer models?

    Several strategies show promise for targeting GJB3:

    • Genetic approaches:

      • shRNA-mediated knockdown has demonstrated efficacy in reducing cancer cell growth and metastatic potential

      • CRISPR-Cas9 gene editing could provide more complete GJB3 ablation

    • Pharmacological targeting:

      • Small molecule gap junction inhibitors (non-specific)

      • Development of GJB3-specific peptidomimetics targeting critical channel domains

      • Combination with autophagy inhibitors (e.g., 3-methyladenine) to enhance therapeutic effects

    • Immunotherapeutic strategies:

      • Targeting the GJB3-neutrophil axis to reverse immunosuppression

      • Combining GJB3 inhibition with immune checkpoint blockade

    Research suggests that combined approaches targeting both GJB3 and its downstream pathways may yield the most significant therapeutic benefits.

  • How can recombinant GJB3 protein be optimally produced and validated for research applications?

    Production of functional recombinant GJB3 requires careful consideration of several factors:

    • Expression systems:

      • Mammalian cell systems (HEK293, CHO) preserve post-translational modifications

      • Insect cell systems balance yield with proper folding

      • Bacterial systems require refolding strategies but offer higher yields

    • Purification strategies:

      • Detergent solubilization optimized for membrane protein extraction

      • Affinity tags positioned to avoid interference with channel formation

      • Size exclusion chromatography to isolate properly assembled hexamers

    • Functional validation:

      • Reconstitution into liposomes to verify channel formation

      • Dye transfer assays in gap junction-deficient cells expressing recombinant GJB3

      • Mass spectrometry to confirm protein integrity and modifications

    • Storage considerations:

      • Stabilization with appropriate detergents or lipid nanodisc incorporation

      • Avoiding repeated freeze-thaw cycles

      • Quality control testing before experimental use

    These methodological considerations are essential for producing recombinant GJB3 that accurately represents the native protein's biological activities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.