Recombinant Human Gap junction beta-6 protein (GJB6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Gap Junction Beta-6 Protein (GJB6)

Recombinant Human Gap Junction Beta-6 protein, encoded by the GJB6 gene, is a crucial component of gap junctions, which are intercellular channels facilitating the exchange of ions, nutrients, and signaling molecules between adjacent cells. This protein, also known as connexin 30 (Cx30), plays a significant role in various tissues, including the inner ear, skin, and hair follicles .

Function and Expression of GJB6

GJB6 is involved in maintaining potassium ion balance in the inner ear, which is essential for hearing. Gap junctions formed by connexin 30 allow the transport of potassium ions and small molecules, contributing to the proper functioning of auditory processes . The protein is also expressed in the skin, particularly in the palms and soles, and in hair follicles and nail beds .

Clinical Significance of GJB6

Mutations in the GJB6 gene have been associated with both syndromic and nonsyndromic hearing loss. Additionally, mutations in this gene are linked to Clouston syndrome, a form of ectodermal dysplasia characterized by skin, hair, and nail abnormalities . A novel missense mutation in the GJB6 gene has been identified in patients with nonsyndromic hearing loss, highlighting the protein's critical role in auditory function .

Data Table: Key Features of GJB6

FeatureDescription
GeneGJB6
ProteinConnexin 30 (Cx30)
FunctionForms gap junctions for ion and molecule transport
TissuesInner ear, skin, hair follicles, nail beds
Clinical AssociationsHearing loss, Clouston syndrome
MutationsLinked to nonsyndromic hearing loss and ectodermal dysplasia

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to fulfill specific format requirements. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All protein shipments are equipped with standard blue ice packs. If you require dry ice, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJB6; Gap junction beta-6 protein; Connexin-30; Cx30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
GJB6
Target Protein Sequence
MDWGTLHTFIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGC KNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETTRKFRRGEKRNDFKDIED IKKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDC FISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESK QNEMNELISDSGQNAITGFPS
Uniprot No.

Target Background

Function
Gap junctions consist of clusters of closely packed pairs of transmembrane channels known as connexons. These connexons allow the diffusion of low-molecular-weight materials between adjacent cells.
Gene References Into Functions
  1. Research indicates that the A88V and G11R mutants of GJB6 can activate the downstream execution factor, caspase-3, through both the extrinsic apoptotic pathway mediated by caspase-8 and the intrinsic apoptotic pathway mediated by caspase-9. This study sheds further light on the mechanisms by which mutant variants A88V and G11R of the GJB6 gene induce HaCaT cell apoptosis. PMID: 30043857
  2. An investigation of stemness-related markers CD133 and cMyc in human samples and rat xenografts revealed a reciprocal relationship between Cx30 and IGF-1R in low-grade and high-grade (HG) glioma. Cx30 was completely absent in HG, while levels of IGF-1R, CD133, and cMyc expression were positively correlated with HG. Cx30 transfection was shown to attenuate the malignant burden of glioma in rat xenografts. PMID: 28875331
  3. Genotype can influence deafness severity, but environmental and other genetic factors may also modulate the severity and progression of GJB2-GJB6 deafness. PMID: 29106882
  4. Data suggests that a recurrent mutation p.A88V in GJB6 plays a pathogenic role in a large Chinese family, emphasizing the importance of genetic testing for this congenital disorder. PMID: 27137747
  5. Cx26 and Cx30 proteins appear not to be co-expressed but form closely associated assemblies of gap junction plaques. PMID: 26941236
  6. The del(GJB6-D13S1854) deletion was found to be highly prevalent in a sample of deaf Syrian families. PMID: 28012540
  7. A new Cx30 mutation has been identified and functionally characterized in a family with hearing impairment associated with previously unreported skin anomalies. PMID: 26620415
  8. Screening for large deletions in the GJB6 gene among Syrians with congenital hearing impairment has been conducted. PMID: 25989237
  9. Findings suggest that SNPs present in the GJB2 and GJB6 genes may have an influence on autosomal recessive nonsyndromic hearing loss (ARNSHL) in humans. PMID: 26075227
  10. Studies have observed that connexin 26 (Cx26) and Cx30 gap junctions readily diffuse within the plaque structures, while Cx43 gap junctions remain persistently immobile for over 2 minutes after bleaching. PMID: 26265468
  11. GJB6 deletions were not detected in this study. PMID: 25288386
  12. The absence of GJB6 mutations and low frequency of SLC26A4 mutations indicate that additional genetic factors may contribute to nonsyndromic hearing loss in India. PMID: 26188157
  13. Results show high mRNA and protein levels for Cx43 and Cx30 in breast cancer, but they are correlated with improved and unfavorable outcomes, respectively, suggesting that they may serve as prognostic markers in breast cancer. PMID: 25383624
  14. Mutations in GJB2, GJB6, and GJA1 are not a primary cause of non-syndromic deafness in black Africans. PMID: 26046157
  15. A study found a missense mutation c.31G>A (p.G11R) in the GJB6 gene as a genotypic characteristic for hidrotic ectodermal dysplasia in the Chinese population. PMID: 23981984
  16. A new extended deletion in the GJB2 and GJB6 gene sequences (approximately 101 kb in size; NC_000013.10:g.20,757,021_20,858,394del) was detected and characterized in three unrelated Russian patients. PMID: 25715449
  17. Mutations in GJB6 and GJA1 are not a major cause of nonsyndromic deafness in this group of Africans from Cameroon and South Africa. There is insufficient evidence to support their testing in a clinical setting for individuals of African ancestry. PMID: 24785695
  18. A wide range of mutations was observed depending on the analyzed region in patients with sensorineural hearing loss (SNHL). 57.86% of patients had affection in one or two alleles in GJB2 or GJB6 genes, while 42.14% were wild-type. In some cases, allele distribution varied by region. PMID: 24774219
  19. In a cohort of Slovakian cochlear implant users, the GJB6 deletion delD13S1830 was identified in only one subject out of 131, in double heterozygosity with a GJB6 mutation. PMID: 23700267
  20. In a cohort of patients with mild to profound autosomal recessive sensorineural hypoacusis, 1% exhibited compound heterozygosity for the GJB6-D13S1830 deletion and 35delG/GJB2. PMID: 23553242
  21. None of the most common types of deletions in the GJB2 gene (c.35delG, c.167delT, or c.235delC) were found in this large cohort of deaf children from Uganda. PMID: 24706568
  22. The GJB2 mutation is not a significant gene in patients diagnosed with hearing loss in sub-Saharan Africa. PMID: 21392827
  23. Increased expression has been observed in Dupuytren's disease. PMID: 24359029
  24. Significant heterogeneity was observed in the alleles and patterns of nonsyndromic hearing impairment (NSHI) inheritance among the subjects studied. PMID: 23684175
  25. Clouston syndrome with a heterozygous GJB6 mutation p.Ala88Val and GJB2 variant p.Val27Ile, revealing mild sensorineural hearing loss and photophobia in a 24-year-old Japanese female, has been documented. PMID: 23863883
  26. These results indicate that the c.35delG mutation is the most common but not the only GJB2 mutation, and the del(GJB6-D13S1830) deletion is absent in this cohort. PMID: 23434199
  27. A recurrent heterozygous mutation c.31G>C (p.Gly11Arg) in the GJB6 gene was identified in a Lebanese-German family with Clouston syndrome. PMID: 23219093
  28. Screening of 77 patients in this study did not reveal the delGJB6-D13S1830 mutation. The results do not suggest a risk of hearing impairment due to this mutation in this specific population. PMID: 23503914
  29. The 35delG mutation was detected in 12 (12.7%) subjects: 10 (83.3%) were homozygous and 2 (16.7%) were heterozygous mutant. The 167delT and del(GJB6-D13S1830) mutations were not detected. PMID: 23171692
  30. Genetic analyses of the GJB2 and GJB6 genes indicated that similar pathological genotypes, occurring with comparable frequencies, may be responsible for both progressive and non-progressive hearing loss. PMID: 22704424
  31. Genetic variants in GJB3 and GJB6 are associated with the pathogenesis of nonsyndromic sensorineural hearing loss. PMID: 22617145
  32. Twenty subjects (59%) had a family history of hearing loss (HL), with 26% specifically reporting familial unilateral HL. Mutational screening revealed sequence variants in the GJB2, GJB3, TECTA, and COCH genes. Two novel mutations were detected in COCH and TECTA. PMID: 22534022
  33. In Cx30, positively charged Glu49 residues establish a potential barrier within the fully open channel. PMID: 22292956
  34. The GJB6 del(GJB6-D13S1830) mutation was not detected in any of the nonsyndromic hearing loss samples. PMID: 22281373
  35. No mutations in GJB6 or POU3F4 were found in nonsyndromic Tibetan Chinese patients with hearing impairment. PMID: 22389666
  36. GJB6 deletion and the A1555G mutation account for a small proportion of nonsyndromic sensorineural hearing loss in the Qatari population. PMID: 22103400
  37. GJB6 mutations are not a common cause of sensorineural hearing loss among the Chinese population. PMID: 22186156
  38. A neonatal hearing screening program in Campania, Italy, did not find any incidence of GJB6 or GJB3 mutations. PMID: 21916817
  39. The study concludes that hearing loss in probands with the del(GJB6-D13S1854) deletion (and a heterozygous mutation in GJB2) results from a lack of functional Cx26 protein. The findings support the presence of GJB2 cis-regulatory element(s) upstream of GJB6. PMID: 21738759
  40. All students with associated GJB2 mutation and GJB6 showed severe to profound hearing loss in both ears. PMID: 22106692
  41. The p.A40V mutation in CX30 causes autosomal-dominant nonsyndromic hearing loss. PMID: 21731760
  42. Mutations in the GJB6 gene are unlikely to be a major cause of non-syndromic deafness in Asian Indians. PMID: 21227513
  43. Some GJB2, GJB3, and GJB6 mutations occurred in deaf students. PMID: 18338563
  44. Heterozygote mutation carriers experienced less hearing impairment, but most other factors showed no differences. These results support the theory of an unidentified genetic factor contributing to hearing loss in some heterozygote carriers. PMID: 21287563
  45. Analysis of GJB2 and GJB6 mutations in Southeastern Brazilians with hereditary nonsyndromic deafness has been conducted. PMID: 20563649
  46. Mutation of the GJB6 gene is infrequent in the Chinese non-syndromic hearing-loss population. PMID: 17438853
  47. The frequency of 35delG/GJB2 and del (D13S1830/GJB6) alleles in patients with non-syndromic deafness was 7.8% and 0.65%, respectively. PMID: 20835527
  48. The generation and characterization of a mouse model for human bilateral middle/high-frequency hearing loss based on the substitution of an evolutionarily conserved threonine by a methionine at position 5 near the N-terminus of Cx30 is described. PMID: 20858605
  49. These results indicate that the expression of connexin 30 is a novel differentiation marker mediating the biological behavior of intestinal phenotype gastric cancer. PMID: 21116114
  50. GJB6-associated deafness was correlated with better oral outcomes in Portuguese cochlear implant users. PMID: 20650534

Show More

Hide All

Database Links

HGNC: 4288

OMIM: 129500

KEGG: hsa:10804

STRING: 9606.ENSP00000241124

UniGene: Hs.511757

Involvement In Disease
Ectodermal dysplasia 2, Clouston type (ECTD2); Deafness, autosomal recessive, 1B (DFNB1B); Deafness, autosomal dominant, 3B (DFNA3B)
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the biological role of GJB6 in the human cochlea?

GJB6 encodes connexin-30, which forms intercellular gap junction channels (GJCs) in the cochlea. These channels facilitate the transfer of electric impulses, small molecules, second messengers, nutrients, and microRNAs between cells . Both GJB6 and GJB2 (encoding connexin-26) play essential roles in the hearing process in adults and during organ morphogenesis in the cochlea . The GJB6 protein is predominantly expressed in the outer sulcus epithelium, root cells, and specific fibrocyte types in the cochlear lateral wall . Notably, GJB6 gene transcripts are present in intermediate cells of the stria vascularis but absent in marginal cells and hair cells .

How are GJB6 and GJB2 functionally related in cochlear tissues?

GJB6 and GJB2 demonstrate a complex interrelationship at both transcriptional and translational levels in the cochlea. Research indicates that cells may contain either GJB2 or GJB6 gene transcripts or both, suggesting specialized gap junction plaques with separate channel permeability and gating properties . In mouse models with GJB2 mutations (such as 35delG homozygous mice), GJB6 protein is significantly downregulated in supporting cells, resulting in total disruption of gap junction channels . This interrelated expression pattern appears to be regulated through specific pathways (potentially involving NF-κB) and contributes to deafness phenotypes . The relationship between these two connexins is further evidenced by the observation that GJB6 knock-out mice exhibit profound hearing loss with a concurrent reduction in GJB2 protein .

What is the distribution pattern of GJB6 transcripts in the human cochlea?

GJB6 mRNA transcripts show a specific distribution pattern throughout the cochlea, as demonstrated by RNAscope in situ hybridization and high-resolution microscopy:

Cochlear RegionGJB6 Expression LevelNotes
Outer sulcus, spiral ligament, stria vascularisHighestDominant expression sites
Supporting cells of organ of CortiPresentImportant for cell communication
Intermediate cells (stria vascularis)PresentGJB2 transcripts absent here
Marginal cellsAbsentNone detected
Hair cellsAbsentNone detected
Spiral ganglion cellsMinimalVery few transcripts detected
Type I fibrocytesHighEspecially near basal cells
Basal cellsModerateGJB2 dominates in this region

Generally, GJB6 transcripts dominate over GJB2 transcripts in most cochlear regions, with the exception of basal cells . The distribution pattern shows some variation across the three cochlear turns, with specific anatomical arrangements in the apical, middle, and lower turns .

What molecular mechanisms underlie the pathogenesis of GJB6 deletions in hereditary hearing loss?

Deletions involving the GJB6 gene represent a significant mechanism underlying autosomal recessive non-syndromic hearing impairment, particularly in cases where patients carry only one mutant GJB2 allele . Research has identified a novel 232 kb deletion (del(GJB6-D13S1854)) that truncates the GJB6 gene and causes hearing impairment when present in trans with pathogenic GJB2 mutations .

The molecular mechanism for this deletion appears to involve unequal homologous recombination between Alu sequences. Specifically, a 282 bp Alu sequence inside GJB6 intron 2 shares 88% identity with another Alu repeat located in direct orientation within the region between markers D13S1854 and D13S1853 . This mechanism of Alu-mediated recombination could potentially generate other deletions at the DFNB1 locus, contributing to the genetic heterogeneity of hereditary hearing loss .

How do GJB6 mutations affect gap junction function at the molecular level?

GJB6 mutations can disrupt gap junction function through multiple mechanisms:

  • Direct protein deficiency: Deletions or nonsense mutations can result in the absence of functional connexin-30 protein.

  • Gap junction assembly disruption: Some mutations may allow protein production but interfere with the formation of functional hexameric connexons or their assembly into complete gap junction channels.

  • Interrelated protein expression: As demonstrated in mouse models, mutations in GJB6 can lead to reduced GJB2 protein expression, and vice versa . In 35delG homozygous mice, the absence of GJB2 leads to significant downregulation of GJB6 protein in supporting cells, resulting in the disruption of gap junction channels .

  • Altered channel properties: Even when channels form, mutations may affect their permeability, gating properties, or regulation, impairing the intercellular transfer of molecules and electrical coupling .

  • Developmental impacts: GJB6 plays important roles in cochlear development and postnatal maturation, so mutations can disrupt critical developmental processes prior to the onset of hearing .

What is the relationship between GJB6 expression and other connexin family members in different tissue types?

GJB6 shows tissue-specific relationships with other connexin family members:

  • Cochlear tissue: GJB6 and GJB2 exhibit interrelated expression at both transcriptional and translational levels, with regulation potentially through the NF-κB pathway .

  • Cardiac tissue: GJB4 (another beta-type connexin) is co-expressed and co-localized with GJA1 in diseased cardiac tissues, including hypertrophic cardiomyopathy and hypertensive hearts, while GJB4 is not expressed in normal cardiac tissue . This suggests differential regulation of connexin expression in cardiac disease states.

  • Tissue-specific expression patterns: Western blot and qPCR analyses in mouse models show that GJB6 expression relative to GJB2 varies across tissues. In tissues with low connexin expression (bladder and tail), GJB6 remains comparable between wild-type and GJB2-mutant mice, while in tissues with high expression (cerebellum and cochlea), GJB6 is reduced in GJB2-mutant mice .

What are the optimal techniques for detecting GJB6 gene transcripts in cochlear tissues?

For sensitive and precise detection of GJB6 gene transcripts in cochlear tissues, RNAscope in situ hybridization (ISH) with fluorescent-tagged probes has proven highly effective . This methodology offers several advantages:

  • Single-transcript resolution: The technique produces punctate signals that represent individual mRNA transcripts, allowing for quantitative assessment of expression levels .

  • Multiplex capability: RNAscope Multiplex Fluorescent v2 assay enables simultaneous detection of up to four RNA targets, facilitating co-expression studies of GJB6 with other genes like GJB2 .

  • High specificity: The probes use 20 ZZ pairs (each consisting of 35-50 nucleotides) that target different regions of the transcript, providing approximately 1000bp coverage for each transcript while preventing cross-detection .

  • Compatibility with fixed tissues: The technique works effectively with paraformaldehyde-fixed sections, making it suitable for archival human cochlear tissue samples .

  • High-resolution visualization: When combined with confocal or super-resolution structured illumination microscopy (SR-SIM), this technique allows precise cellular and subcellular localization of transcripts .

For optimal results, researchers should include positive and negative controls (e.g., ATP1A1, ATP1A2, KCNJ10) to validate the specificity of labeling, and use DAPI counterstaining for nuclear visualization .

How can researchers effectively generate and validate animal models for studying GJB6 mutations?

Creating effective animal models for GJB6 mutations presents several challenges due to the homozygous lethality of some mutations and the complex relationship between GJB6 and GJB2. Based on current research, the following methodological approaches are recommended:

  • Advanced stem cell technologies: Androgenic haploid embryonic stem cell (AG-haESC)-mediated semi-cloning technology has been successfully used to generate heterozygous Gjb2 mutant mice . This approach can potentially be applied to create GJB6 mutant models.

  • Conditional knockdown systems: Inducible Cre-loxP systems allow for temporal control of gene knockdown. By injecting 4-hydroxytamoxifen at different time points after birth, researchers can study the role of GJB6 during specific developmental windows .

  • Validation approaches:

    • Immunostaining: To verify protein expression patterns and localization in cochlear tissues

    • Western blotting: To quantify protein expression levels across different tissues

    • qPCR: To assess transcriptional regulation

    • Auditory brainstem response (ABR) testing: To evaluate hearing function

    • Morphological examination: To assess cochlear development and potential structural abnormalities

  • Combined GJB2/GJB6 models: Given the interrelated expression of these genes, models that allow manipulation of both genes may provide more relevant insights into human pathology .

What are the technical considerations for designing PCR-based diagnostics for GJB6 deletions?

When designing PCR-based diagnostics for GJB6 deletions, researchers should consider the following technical aspects:

  • Multiple deletion detection: Design multiplex PCR assays that can detect different known deletions (e.g., del(GJB6-D13S1830) and del(GJB6-D13S1854)) in a single reaction .

  • Breakpoint junction primers: For known deletions, design primers that flank the breakpoint junction to produce amplicons only in deletion carriers. For example, a PCR product of approximately 560 bp can be obtained from carriers of the del(GJB6-D13S1854) deletion .

  • Complementary approaches: PCR-based methods should be complemented with other techniques:

    • Southern blotting: To detect novel deletions and confirm PCR results

    • Microsatellite marker analysis: To detect inconsistencies in allele segregation that might indicate deletions

    • Haplotype analysis: To map deletion breakpoints and understand their inheritance patterns

  • Sensitivity and specificity considerations: PCR conditions should be optimized to minimize false positives and false negatives, particularly when dealing with heterozygous deletions where wild-type alleles are still present.

  • Validation with known samples: Any new diagnostic test should be validated using samples with previously characterized deletions and appropriate controls.

What methodological approaches can be used to study GJB6-GJB2 interactions in cochlear function?

To investigate the complex interactions between GJB6 and GJB2 in cochlear function, researchers can employ the following methodological approaches:

  • Co-immunoprecipitation studies: To detect direct protein-protein interactions between connexin-30 and connexin-26.

  • Double immunofluorescence: To visualize co-localization of GJB6 and GJB2 proteins in cochlear tissues, with particular attention to:

    • Supporting cells around hair cells

    • Outer sulcus epithelium

    • Lateral wall structures

    • Intermediate and basal cells of the stria vascularis

  • Dual RNA in situ hybridization: Using RNAscope technology to simultaneously detect GJB6 and GJB2 transcripts at the single-cell level .

  • Gap junction functional assays:

    • Dye transfer studies to assess intercellular coupling

    • Electrophysiological measurements to evaluate channel conductance

    • Ca²⁺ wave propagation assays to assess signaling

  • Gene expression regulation studies:

    • Promoter analysis to identify shared regulatory elements

    • ChIP assays to identify transcription factors that may co-regulate both genes

    • Investigation of the NF-κB pathway, which may mediate their co-regulation

  • Single-cell transcriptomics: To characterize cells that express either or both connexins and identify additional genes that may participate in their regulatory network.

What are the implications of GJB6 research for potential gene therapy approaches for hearing loss?

Understanding GJB6 biology has several implications for developing gene therapy approaches for hereditary hearing loss:

  • Target identification: The precise localization of GJB6 transcripts in specific cochlear cell populations helps identify the optimal cellular targets for gene therapy delivery . The highest expression in the outer sulcus, spiral ligament, and stria vascularis suggests these regions should be prioritized.

  • Developmental timing: Research showing a reduction in GJB6 transcripts in the basal turn suggests that gene therapy timing may be critical, with earlier intervention potentially yielding better outcomes .

  • Dual gene approaches: Given the interrelated expression and function of GJB6 and GJB2, comprehensive gene therapy approaches might need to address both genes simultaneously to restore proper gap junction function .

  • Delivery challenges: The complex architecture of the cochlea and the spatial distribution of GJB6 expression present challenges for viral vector delivery. Understanding the exact cellular targets helps optimize delivery strategies and vector design.

  • Functional assessment: The established role of GJB6 in forming gap junction channels provides clear functional endpoints for assessing gene therapy efficacy, including:

    • Restoration of gap junction channel structure

    • Recovery of intercellular communication

    • Prevention or reversal of hair cell degeneration

    • Improvement in hearing function

The detailed characterization of GJB6 distribution in the human cochlea provides valuable information that can guide future gene therapy development and optimize therapeutic approaches for GJB6-related hearing loss .

How might GJB6 research inform our understanding of gap junction proteins in other tissues and diseases?

GJB6 research has broader implications for understanding gap junction biology across different tissues and disease states:

  • Cardiac disease connections: Research shows that other gap junction proteins like GJB4 are expressed in diseased cardiac tissues but not in normal hearts, suggesting that connexin expression patterns may be altered in pathological states . The methodologies used to study GJB6 could be applied to investigate these disease-specific connexin expression patterns.

  • Tissue-specific regulation: The observation that GJB6 and GJB2 show tissue-specific patterns of co-regulation provides insights into how connexin expression is controlled in different cellular contexts . This may inform studies of other connexin family members in various tissues.

  • Structural insights: Understanding how GJB6 forms gap junction channels with specific permeability and gating properties could provide structural insights applicable to other connexin channels .

  • Mutation mechanisms: The identification of Alu-mediated recombination as a mechanism for GJB6 deletions suggests that similar mechanisms may underlie connexin gene mutations in other contexts . This could inform genetic screening approaches for other connexin-related disorders.

  • Therapeutic approaches: Methodologies developed for potential GJB6 gene therapy could serve as templates for addressing other connexin-related diseases, including skin disorders, cataracts, and neuropathies associated with different connexin mutations.

By expanding our understanding of GJB6 biology and pathology, researchers can develop models and approaches that advance the broader field of gap junction research and its applications in various disease contexts.

What experimental approaches can be used to study the potential non-gap junction functions of GJB6?

While GJB6 is primarily known for its role in forming gap junction channels, connexins may also have non-canonical functions. To investigate these potential roles, researchers could employ the following experimental approaches:

  • Hemichannel function assessment: Using selective blockers and dye uptake assays to distinguish between complete gap junction channel functions and hemichannel activities of GJB6.

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening to identify non-connexin interaction partners

    • Proximity labeling techniques (BioID, APEX) to identify proteins in the vicinity of GJB6 in living cells

    • Co-immunoprecipitation followed by mass spectrometry to identify GJB6-associated protein complexes

  • Connexin-deficient cell models: Creating GJB6-null cell lines using CRISPR/Cas9 technology, then reintroducing either wild-type or mutant GJB6 with specific domain deletions to identify regions critical for non-channel functions.

  • Subcellular localization studies: Using high-resolution microscopy to track GJB6 localization throughout the cell cycle and in response to various stimuli, focusing on non-junctional sites.

  • Transcriptomics and proteomics: Comparing gene and protein expression profiles between wild-type and GJB6-deficient cells to identify signaling pathways that might be regulated by GJB6 independent of its channel function.

  • Cell migration and proliferation assays: Assessing whether GJB6 influences these processes in ways that cannot be explained by gap junctional communication alone.

These approaches could reveal novel functions of GJB6 beyond its established role in intercellular communication, potentially expanding our understanding of connexin biology and identifying new therapeutic targets.

What are the common challenges in producing and validating recombinant GJB6 protein for research use?

Producing functional recombinant GJB6 protein presents several technical challenges that researchers should address:

  • Membrane protein expression difficulties:

    • GJB6, like other connexins, is a membrane protein with four transmembrane domains, making heterologous expression challenging

    • Expression systems need to be carefully selected (e.g., insect cells may be preferable to E. coli for proper folding)

    • Codon optimization may be necessary for efficient expression in the chosen system

  • Protein solubility issues:

    • Detergent selection is critical for extracting GJB6 from membranes while maintaining native conformation

    • A detergent screen should be performed to identify optimal solubilization conditions

    • Amphipols or nanodiscs may provide alternatives to detergents for maintaining protein stability

  • Functional validation approaches:

    • Structural integrity can be assessed using circular dichroism spectroscopy

    • Hemichannel function can be evaluated in liposome-based dye release assays

    • Full gap junction channel formation can be tested in cell-based systems where endogenous connexins are knocked out

  • Antibody specificity concerns:

    • Commercial antibodies should be validated using both positive controls (tissues known to express GJB6) and negative controls (GJB6-knockout tissues)

    • Cross-reactivity with other connexins, particularly GJB2, should be carefully evaluated

    • Multiple antibodies targeting different epitopes should be compared for consistency

  • Quality control measures:

    • Size exclusion chromatography to verify oligomeric state (hexameric connexons)

    • Mass spectrometry to confirm protein identity and purity

    • Functional assays to verify channel-forming ability

    • Storage stability tests to determine optimal conditions for preserving activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.