Recombinant Human Gap junction delta-4 protein (GJD4)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

GJD4 is a 40.7 kDa protein encoded by the GJD4 gene on human chromosome 10 . Its structure includes four transmembrane domains, two extracellular loops, and intracellular domains . Key features include:

ParameterDetailsSource
Molecular Weight40.7 kDa
Transmembrane DomainsFour, with cytoplasmic N- and C-termini
Isoelectric PointNot explicitly reported
Post-Translational ModificationsNone specified

The protein forms hemichannels by oligomerizing into hexamers, which dock with adjacent cells to create functional gap junction channels .

GJD4 is utilized in:

  1. Antibody Production

    • Rabbit polyclonal antibodies (e.g., ABIN202357, ABIN630270) target GJD4 for Western blotting and immunoprecipitation .

    • Applications include studying gap junction dynamics in cardiac models and skeletal muscle regeneration .

  2. Functional Studies

    • Investigates GJD4’s role in intercellular signaling and membrane transport .

    • Assesses interactions with other connexins (e.g., GJA1) in disease models .

  3. Compound Screening

    • Tests modulators of gap junction activity for therapeutic potential .

Tissue Expression Profile

The Human Protein Atlas reports GJD4 expression in multiple tissues, though specific data remains sparse .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
GJD4; CX40.1; Gap junction delta-4 protein; Connexin-40.1; Cx40.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-370
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GJD4
Target Protein Sequence
MEGVDLLGFLIITLNCNVTMVGKLWFVLTMLLRMLVIVLAGRPVYQDEQERFVCNTLQPG CANVCYDVFSPVSHLRFWLIQGVCVLLPSAVFSVYVLHRGATLAALGPRRCPDPREPASG QRRCPRPFGERGGLQVPDFSAGYIIHLLLRTLLEAAFGALHYFLFGFLAPKKFPCTRPPC TGVVDCYVSRPTEKSLLMLFLWAVSALSFLLGLADLVCSLRRRMRRRPGPPTSPSIRKQS GASGHAEGRRTDEEGGREEEGAPAPPGARAGGEGAGSPRRTSRVSGHTKIPDEDESEVTS SASEKLGRQPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSGAP HLRARKSEWV
Uniprot No.

Target Background

Function
A gap junction comprises a cluster of closely packed pairs of transmembrane channels, known as connexons, that facilitate the diffusion of low molecular weight materials between adjacent cells.
Gene References Into Functions
  1. Human deltoid muscle biopsies from 5 Chilean dysferlinopathy patients revealed the presence of muscular connexins (Cx40.1, Cx43, and Cx45). PMID: 27229680
  2. Connexin40 plays a regulatory role in platelet function. PMID: 24096827
  3. The data indicate that induced expression of either Cx37 or Cx40 in Cx43-expressing cells can selectively alter the intercellular exchange of specific molecules without affecting the transfer of others. PMID: 22729648
Database Links

HGNC: 23296

OMIM: 611922

KEGG: hsa:219770

STRING: 9606.ENSP00000315070

UniGene: Hs.638922

Protein Families
Connexin family, Delta-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Expressed in pancreas, kidney, skeletal muscle, liver, placenta, and heart.

Q&A

What is GJD4 and what is its role in cellular communication?

GJD4 (gap junction protein, delta 4, 40.1kDa) is a connexin protein involved in the formation of gap junctions, which are intercellular conduits that directly connect the cytoplasms of adjacent cells. Each gap junction channel is formed by docking of two hemichannels, with each hemichannel containing six connexin subunits . GJD4 is also known by several synonyms including connexin 40.1 (CX40.1), FLJ90023, and connexin-40.1 . The protein plays a crucial role in cell-cell signaling and communication pathways , allowing for the direct exchange of ions, metabolites, and second messengers between connected cells.

Gap junction proteins like GJD4 mediate electrical coupling between cells, where voltage changes in one cell can induce corresponding voltage changes in connected cells. This coupling is proportional to the difference in voltages between the coupled cells, multiplied by the gap junction strength .

What biological processes is GJD4 involved in according to Gene Ontology annotations?

According to Gene Ontology annotations from the Rat Genome Database, GJD4 is involved in several key biological processes:

  • Cell communication (involved in) - supported by InterPro database annotations

  • Cell-cell signaling (involved in) - based on biological ancestry evidence

  • Regulation of satellite cell activation involved in skeletal muscle regeneration (acts upstream of or within) - supported by both orthology to mouse Gjd4 and direct experimental evidence

  • Transmembrane transport (involved in) - inferred from electronic annotation

These annotations indicate that GJD4 plays multiple roles in cellular processes, particularly those involving intercellular communication and tissue regeneration.

How do gap junction proteins like GJD4 contribute to neural network regulation?

Gap junction proteins like GJD4 play a critical role in neural network regulation through electrical coupling between neurons. In neural networks, gap junctions are primarily found between inhibitory neurons . When one neuron experiences voltage changes (hyperpolarization or depolarization), these changes are transmitted to connected neurons via gap junctions.

Additionally, when a neuron fires an action potential, it generates a "spikelet" in coupled neurons. This electrical coupling contributes to network synchronization, particularly in generating oscillatory activity such as gamma oscillations . The strength of gap junction coupling can influence whether neural networks operate in asynchronous irregular (AI) regimes or synchronous regular (SR) regimes that produce rhythmic activity .

Gap junction plasticity—the activity-dependent strengthening or weakening of gap junction connections—serves as a homeostatic mechanism that maintains a balance between these network states, allowing for dynamic regulation of neural synchrony .

How does gap junction plasticity affect network oscillations and what implications does this have for GJD4 function?

Gap junction plasticity serves as a homeostatic mechanism for neural oscillations by maintaining a balance between different network states . In neural networks, gap junctions can undergo activity-dependent changes in strength similar to chemical synapses. While activity-dependent long-term potentiation of gap junctions (gLTP) has not been conclusively demonstrated in the mammalian brain, there is evidence for activity-dependent short-term potentiation in vertebrates .

Research suggests that gap junction depression can be induced by bursting activity, while single spikes may induce potentiation . This plasticity allows networks to self-regulate their oscillatory behavior. For GJD4 specifically, understanding its plasticity properties would be critical for determining its role in regulating network dynamics.

Gap junction plasticity enhances the ability of neuronal sub-populations to synchronize. When two networks with different intrinsic oscillation frequencies are coupled by gap junctions, the cross-network connections can reduce the frequency and phase differences between them, allowing them to oscillate in harmony . This synchronization is believed to be one possible mechanism of information transfer between neural networks .

What experimental approaches can be used to investigate the role of GJD4 in gap junction-mediated network synchronization?

To investigate GJD4's role in network synchronization, researchers can employ several approaches:

  • Dual/Multiple Patch-Clamp Recordings: Simultaneously record from multiple neurons to measure electrical coupling and spikelets mediated by gap junctions containing GJD4.

  • Optogenetic Manipulation: Use light-sensitive channels to precisely control the activity of neurons expressing GJD4 to determine how activation or inhibition affects network synchrony.

  • Mathematical Modeling: Implement computational models that incorporate GJD4-specific properties to predict network behavior under various conditions. These models can include parameters such as:

    • Gap junction coupling strength (γ)

    • External drive to inhibitory neurons (ν)

    • Membrane time constants

    • Synaptic time constants (τ)

The mathematical representation of gap junction-mediated currents between inhibitory neurons i and j can be modeled as:
Igap=γij(ViVj)I_{gap} = \gamma_{ij}(V_i - V_j)

where γ is the gap junction coupling strength and V represents membrane potentials.

  • Network Activity Analysis: Measure population activity and oscillatory patterns in normal conditions versus when GJD4 is knocked down or overexpressed.

What is known about the molecular structure of GJD4 and how does it differ from other connexin proteins?

While the search results don't provide specific details about GJD4's molecular structure, gap junction proteins generally share a common structural organization. Connexins typically have four transmembrane domains, two extracellular loops, one cytoplasmic loop, and cytoplasmic N- and C-terminal regions.

The human GJD4 protein consists of 370 amino acids according to available recombinant protein information , while the mouse ortholog contains 364 amino acids . This slight difference in length suggests potential species-specific variations in the protein that might affect its functional properties.

For comprehensive structural analysis, researchers would need to:

  • Conduct sequence alignment with other connexins to identify conserved domains

  • Perform crystallography or cryo-EM studies to determine the three-dimensional structure

  • Investigate structure-function relationships through site-directed mutagenesis

What expression systems are available for producing recombinant GJD4 protein for research?

According to the available data, recombinant GJD4 proteins can be produced using various expression systems:

Expression SystemSpecies SourcesTags AvailableNotes
Mammalian CellsMouseHisProvides native-like post-translational modifications
HEK293MouseHis, Fc, AviSuitable for proteins requiring mammalian processing
Wheat GermHumanNon-taggedCell-free system for potentially toxic proteins
In Vitro Cell Free SystemHumanFull Length (665 amino acids)Useful for difficult-to-express proteins
E. coliHuman, Mouse, Macaca fascicularisHisHigh yield but limited post-translational modifications

The choice of expression system depends on the research objectives:

  • For structural studies requiring high protein yields, E. coli systems may be preferable

  • For functional studies requiring proper folding and post-translational modifications, mammalian systems like HEK293 cells are recommended

  • For proteins that might be toxic to host cells, cell-free systems offer advantages

How can researchers effectively study GJD4-mediated coupling in cellular models?

To study GJD4-mediated coupling in cellular models, researchers can employ several techniques:

  • Dye Transfer Assays: Inject fluorescent dyes like Lucifer Yellow into one cell and monitor transfer to adjacent cells. The rate and extent of dye spread indicate gap junction functionality.

  • Electrophysiological Techniques: Utilize dual whole-cell patch clamp to measure electrical coupling coefficients between cell pairs expressing GJD4.

  • Calcium Imaging: Monitor calcium wave propagation between connected cells as an indicator of functional gap junction communication.

  • FRAP (Fluorescence Recovery After Photobleaching): Photobleach one cell in a connected network and measure the rate of fluorescence recovery, which depends on gap junction-mediated molecular exchange.

  • Expression Systems: Create cellular models using:

    • Stable cell lines expressing GJD4

    • Primary cultures from tissues known to express GJD4

    • Neuronal cultures to study network synchronization

When designing these experiments, it's important to account for the gap junction-mediated current characteristics, which follow a differential equation model where the current between cells is proportional to their voltage difference .

What analytical techniques can be used to measure changes in gap junction plasticity involving GJD4?

Measuring changes in gap junction plasticity requires techniques that can detect dynamic alterations in gap junction strength and number:

  • Long-term Electrophysiological Recordings: Monitor changes in coupling coefficients between cell pairs before and after stimulation protocols designed to induce plasticity.

  • Live Cell Imaging: Use GJD4 tagged with fluorescent proteins to track changes in gap junction plaque size, number, and distribution over time in response to different activity patterns.

  • Mathematical Analysis of Network Behavior: Implement computational models to infer changes in gap junction coupling from observed changes in network dynamics:
    Igap=γij(ViVj)I_{gap} = \gamma_{ij}(V_i - V_j)

    Where changes in the effective coupling coefficient γ can indicate plasticity.

  • Protein Phosphorylation Assays: Detect post-translational modifications associated with gap junction plasticity using phospho-specific antibodies.

  • Quantitative Analysis of Oscillatory Activity: Measure changes in network oscillation frequency and coherence as indicators of altered gap junction function:

    • When gap junction coupling increases, networks tend to shift from asynchronous irregular (AI) to synchronous regular (SR) regimes

    • The frequency of oscillations relates to the resonance properties of individual neurons, which is influenced by gap junction coupling

What is known about GJD4's role in skeletal muscle regeneration?

Gene Ontology annotations indicate that GJD4 acts upstream of or within the regulation of satellite cell activation involved in skeletal muscle regeneration . This function has been demonstrated in mouse models and inferred for rat and human orthologs. Satellite cells are muscle stem cells that remain quiescent until activated by injury or exercise, at which point they proliferate and differentiate to repair damaged muscle tissue.

GJD4 likely facilitates communication between satellite cells and/or between satellite cells and other cell types during the regeneration process. Gap junction-mediated coupling could coordinate activation signals across populations of satellite cells, ensuring a synchronized regenerative response.

Research methodologies to further investigate this role could include:

  • Conditional knockout of GJD4 in satellite cells to assess impacts on regeneration

  • Live imaging of GJD4-mediated coupling during the regeneration process

  • Analysis of GJD4 expression patterns before, during, and after muscle injury

How does GJD4 function differ from other connexins in neural network regulation?

While the search results don't provide direct comparisons between GJD4 and other connexins in neural networks, general principles of connexin function in neural networks can be inferred:

Different connexin subtypes create gap junctions with distinct conductance properties, voltage sensitivities, and permeability characteristics. These differences allow for specialized functions within neural circuits. In neural networks, gap junctions containing different connexins might:

  • Contribute differently to network synchronization based on their conductance properties

  • Show different plasticity responses to activity patterns

  • Have distinct roles in different brain regions or cell types

  • Exhibit different interactions with chemical synaptic transmission

For GJD4 specifically, research suggests it may have specialized roles in certain neural circuits, but more comparative studies are needed to fully characterize its unique contributions relative to other connexins.

Neural network models indicate that gap junctions promote synchronization by:

  • Reducing sub-threshold voltage differences between neurons

  • Allowing positive coupling through spikelets when one neuron fires

  • Contributing to the emergence of oscillatory activity, particularly in the gamma range

What are the current limitations in GJD4 research and how might they be addressed?

Several limitations exist in current GJD4 research:

  • Limited Direct Studies: Most gap junction research focuses on more prevalent connexins, with fewer studies specifically targeting GJD4.

  • Technical Challenges in Gap Junction Research: Gap junctions are difficult to study due to:

    • Their location at cell-cell interfaces

    • The presence of multiple connexin types in most cells

    • Challenges in distinguishing electrical versus chemical coupling in complex networks

  • Knowledge Gaps in Plasticity Mechanisms: While gap junction plasticity is theorized, the molecular mechanisms—particularly for GJD4—remain largely unexplored. As noted in the research: "Activity-dependent gap junction long-term potentiation (gLTP) has not been reported experimentally yet in the mammalian brain" .

These limitations could be addressed through:

  • Development of GJD4-specific antibodies and reporter constructs

  • Application of super-resolution microscopy techniques to visualize gap junction dynamics

  • Creation of conditional and cell-type-specific GJD4 knockout models

  • Utilization of in silico modeling to predict GJD4 functions that can then be tested experimentally

What potential therapeutic applications might emerge from deeper understanding of GJD4 function?

Understanding GJD4 function could lead to several therapeutic applications:

  • Neurodevelopmental and Neuropsychiatric Disorders: Gap junctions contribute to neural network synchronization, which is often disrupted in conditions like epilepsy, autism spectrum disorders, and schizophrenia. Modulating GJD4 function could potentially normalize aberrant network activity.

  • Muscle Regeneration Therapies: Given GJD4's role in regulating satellite cell activation during skeletal muscle regeneration , therapies targeting GJD4 could enhance muscle repair in muscular dystrophies, age-related sarcopenia, or after traumatic injuries.

  • Cancer Treatment: Gap junctions often show altered expression in cancer cells. Understanding GJD4's specific contributions could lead to therapies that restore normal cell-cell communication in tumors.

  • Cardiac Arrhythmias: While not specifically mentioned for GJD4, connexins play crucial roles in cardiac conduction. If GJD4 is expressed in cardiac tissue, modulating its function could potentially address certain arrhythmias.

Therapeutic approaches might include:

  • Small molecules that modulate GJD4 channel opening or closing

  • Gene therapy to restore normal GJD4 expression

  • Peptide mimetics that target specific domains of GJD4 to alter its function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.