Recombinant Human Gap junction gamma-1 protein (GJC1)

Shipped with Ice Packs
In Stock

Description

Secondary Structure Analysis

Circular dichroism (CD) spectroscopy studies have revealed important insights into the secondary structure of GJC1, specifically its carboxyl-terminal (CT) domain. Research indicates that the Cx45CT domain exhibits both α-helical and random coil structures, with approximately 18-19% α-helical content at both pH 5.8 and 7.5 .

The CD spectra characteristically show two peak minima at 206 and 222 nm, with the 206 nm minimum being more negative than the 222 nm value. This pattern is indicative of a protein containing both α-helical and random coil structures. Adding the helix-stabilizing cosolvent 2,2,2-Trifluoroethanol (TFE) causes a shift in these peaks, suggesting that TFE stabilizes the protein's innate α-helical structure .

Structural analysis has identified that the GJC1 protein contains:

  • One region of α-helical structure

  • Two intrinsically disordered domains

  • A dimerization interface mediated by hydrophobic contacts in the α-helical region

Functional Mechanisms of GJC1

GJC1 serves as a fundamental component of gap junctions, which are specialized intercellular connections formed by the docking of hexameric assemblies called connexons from adjacent cells. These structures facilitate direct cell-to-cell communication, allowing the exchange of various molecules between neighboring cells .

Intercellular Communication

Gap junctional intercellular communication (GJIC) mediated by GJC1 enables the diffusion and exchange of:

  • Small ions (K+, Ca2+)

  • Second messengers (IP3, cAMP)

  • Nutrients and metabolites (glucose)

  • Low molecular weight molecules (under 1-1.5 kDa)

This intercellular communication is essential for maintaining tissue homeostasis, coordinating cellular responses, and regulating various physiological processes .

Molecular Interactions

NMR spectroscopy studies have identified multiple molecular partners that interact with the Cx45CT domain, revealing mechanisms of gap junction regulation. These interactions include:

Molecular PartnerInteracting RegionFunction
ZO-1 PDZ-2 domainC-terminus of Cx45CT (K371-I396)Gap junction regulation
c-Src SH3 domainN-terminus (L269-N314)Signaling pathway integration
Nedd4 WW2 domainN-terminus (L269-N314)Protein degradation regulation
TSG101 UEV domainN-terminus (L269-N314)Trafficking regulation
Dyn2 PH domainN-terminus (L269-N314)Endocytosis regulation
Calmodulin (CaM)N-terminus (L269-N314)Calcium-dependent regulation

These interactions provide insight into how GJC1 function is regulated through protein-protein interactions, with the intrinsically disordered domains playing a crucial role in binding to various regulatory proteins .

Pathway Involvement and Cellular Function

GJC1 participates in multiple cellular pathways that are essential for normal physiological functions. Understanding these pathways provides insights into the protein's broader biological significance.

Key Pathways Involving GJC1

Research has identified several important pathways in which GJC1 plays a significant role:

Pathway NameRelated ProteinsFunctional Significance
Calcium Regulation in the Cardiac CellGNB5B, RGS17, ADRA1D, FKBP1A, ADRB1, CASQ1Cardiac function and rhythm maintenance
Electric Transmission Across Gap JunctionsPANX1A, GJA10, PANX2, PANX1B, PANX1Electrical coupling between cells
Gap Junction AssemblyGJA4, GJB4, GJB3, CX27.5, GJA8, GJB7Formation and organization of gap junctions
Gap Junction TraffickingGJB4, GJB5, GJA5, GJB2, MYO6B, GJA4Transport and localization of connexins
Neuronal SystemKCNH8, HCN4, KCNF1, KCNG3, SLC1A3B, KCND1Neural communication and signaling

These pathways highlight the multifunctional nature of GJC1 and its importance in various physiological processes, particularly in tissues where rapid and coordinated cellular responses are essential, such as the heart and nervous system .

Clinical Relevance and Disease Associations

GJC1 has been implicated in several human diseases, highlighting its clinical significance. Understanding these associations provides potential insights into disease mechanisms and therapeutic strategies.

Associated Diseases

Several diseases have been linked to alterations in GJC1 function:

  • Oculodentodigital Dysplasia: A developmental disorder affecting the eyes, teeth, and digits

  • Craniometaphyseal Dysplasia: A rare genetic disorder characterized by progressive thickening of craniofacial bones

  • Heart Disease: Alterations in cardiac gap junctions, including those formed by GJC1, can contribute to arrhythmias and other cardiac dysfunctions

These disease associations underscore the importance of GJC1 in normal development and physiological function, particularly in specialized tissues like the heart .

Recombinant Human GJC1 Production and Applications

The production of recombinant human GJC1 protein enables detailed biochemical and structural studies, as well as the development of research tools such as antibodies for detecting and studying the protein in various contexts.

Expression Systems

Recombinant GJC1 can be produced in various expression systems:

Expression SystemAdvantagesApplications
E. coliHigh yield, cost-effectiveStructural studies, antibody production
Mammalian Cells (HEK293)Proper folding, post-translational modificationsFunctional studies, interaction analyses
Cell-free Protein SynthesisRapid production, avoids cellular toxicityStructural biology, high-throughput screening
Wheat GermEukaryotic processing, high purityComplex protein studies

Purification Methods and Tags

Recombinant GJC1 proteins can be engineered with various purification tags to facilitate isolation and detection:

  • His-tag: For metal affinity chromatography purification

  • Strep-tag: For streptavidin-based affinity purification

  • Fc-tag: For protein A/G-based purification

  • GST-tag: For glutathione-based affinity purification

These tagging strategies enable the production of high-purity protein for research applications, with purity levels typically exceeding 95% after appropriate purification steps .

Research Applications

Recombinant human GJC1 protein finds applications in various research contexts:

  • Structural studies: Investigating protein conformation and dynamics

  • Binding assays: Characterizing interactions with regulatory proteins

  • Antibody development: Generating specific detection reagents

  • Functional studies: Examining channel properties in reconstituted systems

  • Drug screening: Identifying compounds that modulate GJC1 function

Current Research and Future Directions

Recent research on GJC1 has provided significant insights into its structure, function, and regulation. These advances open new avenues for understanding its role in health and disease.

Interaction Networks

Studies have identified multiple molecular partners that interact with GJC1, including components of signaling pathways and trafficking machinery. These interactions suggest that GJC1 functions within a complex regulatory network that modulates gap junction assembly, maintenance, and turnover .

Future Research Directions

Several promising areas for future research on GJC1 include:

  • Development of specific modulators of GJC1 function for potential therapeutic applications

  • Investigation of the role of GJC1 in development and disease processes

  • Characterization of heteromeric channels formed by GJC1 and other connexins

  • Elucidation of post-translational modifications that regulate GJC1 activity

  • Understanding the dynamics of GJC1 trafficking and turnover in different cellular contexts

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJC1; GJA7; Gap junction gamma-1 protein; Connexin-45; Cx45; Gap junction alpha-7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
GJC1
Target Protein Sequence
MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGC ENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMR WKQHRALEETEEDNEEDPMMYPEMELESDKENKEQSQPKPKHDGRRRIREDGLMKIYVLQ LLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTG LCLLLNIWEMLHLGFGTIRDSLNSKRRELEDPGAYNYPFTWNTPSAPPGYNIAVKPDQIQ YTELSNAKIAYKQNKANTAQEQQYGSHEENLPADLEALQREIRMAQERLDLAVQAYSHQN NPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI
Uniprot No.

Target Background

Function
Gap junctions are composed of clusters of tightly packed pairs of transmembrane channels known as connexons. These connexons facilitate the diffusion of low molecular weight materials between adjacent cells.
Gene References Into Functions
  1. Our research highlighted the critical role of CX45 in reprogramming, which may increase the cell division rate and lead to accelerated kinetics in iPSCs production. PMID: 28352086
  2. Human Cx40/Cx45 and Cx43/Cx45 heterotypic gap junctions were investigated through recombinant expression in GJ deficient cells. PMID: 28760564
  3. Observations involving both N- and C-domains of CaM interacting with the Cx45 peptide differ from the established interaction with Cx50 from another connexin family. PMID: 28963343
  4. Human deltoid muscle biopsies from 5 Chilean dysferlinopathy patients exhibited the presence of muscular connexins (Cx40.1, Cx43, and Cx45). PMID: 27229680
  5. Connexin45 exhibits significantly faster gating kinetics compared to connexin43. PMID: 25401181
  6. Results indicated that the expression of Cx26 and Cx45 did not hold prognostic value, while Cx43 was upregulated in tumor epithelia and membrane Cx43 expression correlated with shorter overall survival time. PMID: 24788723
  7. Gap junctional intercellular communication in human bladder smooth muscle cells and suburothelial myofibroblasts depends on Cx43 rather than Cx45. PMID: 21674053
  8. Our findings suggest that GJA7 alterations have minimal or no genetic relevance in nonsyndromic hearing loss in populations from Turkey, South Africa, United Kingdom, United States, and China. PMID: 21254920
  9. DNA hypermethylation within the promoter region of GJC1, encoding connexin45, is a significant mechanism in silencing gene expression in colorectal cancer. PMID: 21406965
  10. The study demonstrates that fusion of a V5/6-His tag (hexa moiety Mr = 0.93 kDa) to the CT segment of Cx40, Cx43, and Cx45 does not hinder the cells from forming channels. PMID: 21424225
  11. Connexin genes Gjd2 coding for mCx36, Gjc1 coding for mCx45, and Gja10 coding for mCx57 in the mouse, along with a subset of 4 connexin genes, including the unique GJA9 (Cx59) and GJA10 (Cx62), were detectable as transcript isoforms in the human retina. PMID: 20979653
  12. Results indicate that Cx40, Cx37, Cx43, and Cx45 were expressed within the glomeruli. PMID: 20530971
  13. Studies indicate that 21 distinct Cxs have been identified, generally named according to their approximate molecular mass in kDa, e.g., Cx32, Cx43, and Cx45. PMID: 19883623
  14. Data suggests that the dynamic changes in connexins 43, 40, and 45 during mouse cardiac development seem to be mirrored in human development. PMID: 12064615
  15. Abnormal expression of connexin43 and connexin45 in nasopharynx tissues may be associated with cancerization and squamatization of human nasopharynx tissue. PMID: 12452056
  16. mRNA levels of connexins in different sizes of luteinized normal and hyperstimulated follicles. PMID: 14667880
  17. The staining patterns for Cx45 were characterized by granular cytoplasmic staining. PMID: 14766937
  18. Cx45 exhibits a complex binding interaction with zonula occludens-1 (ZO-1) that involves either an extended carboxyl terminal domain or two distinct binding sites. PMID: 16463142
  19. Cx40/Cx45 junctions demonstrate electrical signal transfer asymmetry that can be modulated between unidirectional and bidirectional by slight changes in the difference between holding potentials of the coupled cells. PMID: 17189315
  20. Evidence suggests a cross-talk between CFTR and a variety of gap junction channels. Cytoskeletal scaffolding proteins and/or other intermediate cytoplasmic proteins likely play a role in the interaction between CFTR and connexins. PMID: 17546509

Show More

Hide All

Database Links

HGNC: 4280

OMIM: 608655

KEGG: hsa:10052

STRING: 9606.ENSP00000333193

UniGene: Hs.712052

Protein Families
Connexin family, Gamma-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is GJC1 and what is its role in cellular communication?

GJC1 (Gap Junction Protein Gamma 1) is a member of the connexin gene family that encodes a component of gap junctions. These specialized cell-cell contacts form intercellular channels that allow the passive diffusion of small molecules (up to 1 kDa) between adjacent cells, including nutrients, metabolites like glucose, ions (K+, Ca2+), and second messengers (IP3, cAMP) . GJC1 was previously designated as GJA7 and functions as a critical element in intercellular communication, particularly in tissues requiring coordinated cellular activity .

To study GJC1 function, researchers typically use techniques such as:

  • Immunofluorescence microscopy to visualize protein localization

  • Dye transfer assays to assess gap junctional communication

  • Patch clamp electrophysiology to measure channel conductance

  • Molecular approaches to manipulate expression levels

How does GJC1 differ from other connexin family members?

GJC1 belongs to the gamma subfamily of connexins, distinguishing it structurally and functionally from other connexin types. While GJC1 shares the basic hexameric structure common to all connexins, it possesses unique properties:

Connexin TypePrevious NameKey Expression SitesNotable FeaturesMolecular Weight
GJC1 (Gamma-1)GJA7Diverse tissuesForms heteromeric channels~45 kDa
GJA1 (Alpha-1)Cx43Brain, heartMost widely expressed connexin~43 kDa
GJC2 (Gamma-2)GJA12/Cx47Primarily CNSImportant paralog of GJC1~47 kDa

Research methodologies should account for these differences when designing experiments targeting specific connexin functions. When investigating GJC1 specifically, researchers should employ gene-specific primers for PCR and validated antibodies that do not cross-react with other connexins .

What are the optimal cell lines for recombinant expression of human GJC1?

The selection of an appropriate cell model is critical for studying GJC1 function. Recent research indicates that genetically engineered human embryonic kidney (HEK293) cells with endogenous connexins knocked out provide an excellent system for recombinant expression of human connexins .

For GJC1 research specifically, consider these expression systems:

  • Double knockout (DKO) HEK293 cells: These cells have both Cx43 and Cx45 knocked out using CRISPR-Cas9, showing no background gap junction coupling. They can be readily transfected with human connexin genes to form functional gap junctions and are accessible for dual patch clamp analysis .

  • Single knockout cell lines: For studying interactions between GJC1 and specific endogenous connexins, single knockout Cx43 or Cx45 HEK cell lines allow characterization of gap junction channels with controlled expression levels .

  • N2A cells: Neuroblastoma cells with low endogenous connexin expression, suitable for transient transfection experiments.

Traditional systems like Xenopus oocytes have significant limitations, including non-mammalian post-translational modifications and specialized equipment requirements . Similarly, other commonly used models such as SKHep1 cells show relatively high background gap junction coupling (~15%) , potentially complicating interpretation of results specific to GJC1.

How can I verify successful expression and functionality of recombinant GJC1 in cell culture models?

Verification of GJC1 expression and functionality requires a multi-faceted approach:

  • Protein expression verification:

    • Western blotting using GJC1-specific antibodies

    • Immunofluorescence microscopy to confirm membrane localization and plaque formation

    • Flow cytometry for quantitative assessment of expression levels

  • Functional assessment:

    • Dye transfer assays using low molecular weight tracers (e.g., Lucifer Yellow)

    • Dual patch clamp electrophysiology to measure junctional conductance

    • Voltage-gating analysis to confirm channel-specific properties

  • Control experiments:

    • Compare with cells transfected with empty vector (expressing only reporter GFP)

    • Assess colocalization with established gap junction markers

    • Confirm lack of gap junction coupling in untransfected DKO cells

When analyzing voltage-gating properties, construct normalized steady-state junctional conductance (Gj,ss) plots against transjunctional voltage (Vj) and fit with Boltzmann equations to confirm signature voltage-dependent gating characteristic of GJC1 .

How is GJC1 implicated in cardiac pathophysiology compared to other connexins?

While GJA1 (Cx43) is the predominant cardiac connexin, recent evidence suggests GJC1 may play specialized roles in cardiac pathophysiology. Research comparing GJC1 with other connexins like GJB4 shows distinct expression patterns in disease states:

  • Normal vs. diseased tissue expression: Unlike GJB4, which appears exclusively in diseased hearts, GJC1 shows more complex regulation patterns across cardiac tissues .

  • Localization patterns: In diseased cardiac tissue, connexins can exhibit altered localization. GJA1 shows both intercalated disc localization and lateralization, whereas other connexins like GJB4 maintain more consistent localization patterns .

  • Functional implications: For experimental investigation of GJC1's cardiac role, researchers should:

    • Compare expression levels across multiple cardiac pathologies using RT-qPCR

    • Analyze protein localization in tissue sections from normal and diseased hearts

    • Assess functional coupling in primary cardiomyocytes and relevant model systems

    • Implement genetic manipulation in animal models to establish causality

Methodology for cardiac studies should include immunohistochemistry with careful attention to colocalization with other cardiac connexins, and functional studies addressing the specific conductance properties of GJC1-containing channels.

What is the evidence for GJC1's role in tumor suppression or progression?

While GJA1 (Cx43) has been directly implicated in tumor suppression , the specific role of GJC1 in cancer biology remains an area requiring further research. Based on connexin family studies:

  • Mechanism insights from related connexins: Cx43 suppresses human glioblastoma cell growth by downregulating monocyte chemotactic protein-1 (MCP-1) . This suggests a potential pathway for investigation with GJC1.

  • Experimental approaches for GJC1 cancer studies:

    • Stable transfection of GJC1 in cancer cell lines followed by proliferation and migration assays

    • Colony formation in soft agar to assess anchorage-independent growth

    • Cytokine arrays to identify downstream mediators (similar to the approach used for Cx43)

    • In vivo tumor models using GJC1-expressing cells

  • Analytical considerations:

    • Distinguish between channel-dependent and channel-independent effects

    • Assess interactions with established oncogenes and tumor suppressors

    • Evaluate tissue-specific effects that may vary across cancer types

Researchers should note that gap junctional intercellular communication is generally reduced in cancer cells, and restoration of connexin expression often correlates with decreased proliferation .

How do post-translational modifications affect GJC1 trafficking and function?

Post-translational modifications (PTMs) significantly influence connexin trafficking, assembly, and channel gating. For GJC1 research, consider:

  • Phosphorylation:

    • Identify potential phosphorylation sites using bioinformatics tools

    • Perform site-directed mutagenesis to generate phosphomimetic (S/T→D/E) or phosphodeficient (S/T→A) mutants

    • Use phospho-specific antibodies to monitor phosphorylation states

    • Employ phosphatase inhibitors to assess the role of constitutive phosphorylation

  • Ubiquitination and SUMOylation:

    • Analyze ubiquitination patterns using immunoprecipitation followed by Western blotting

    • Employ proteasome inhibitors to assess degradation pathways

    • Investigate the role of deubiquitinating enzymes in regulating GJC1 levels

  • Glycosylation:

    • Test the effects of glycosylation inhibitors on GJC1 trafficking

    • Use enzymatic deglycosylation to assess the contribution of sugar moieties to protein stability

When studying PTMs, it's critical to use a human cell context, as mammalian cells provide the appropriate enzymatic machinery for these modifications. Non-mammalian systems like Xenopus oocytes have different patterns of phosphorylation, glycosylation, and ubiquitination , potentially leading to misleading results.

What are the optimal approaches for analyzing GJC1 channel properties at the single-channel level?

Single-channel analysis provides critical insights into the biophysical properties of GJC1 channels. Advanced methodological considerations include:

  • Dual patch-clamp technique:

    • Use cell expression systems with appropriate low endogenous connexin levels

    • DKO HEK293 cells are particularly suitable for single-channel recordings

    • Maintain transfection conditions that lead to minimal gap junction coupling

    • Apply voltage steps of varying amplitudes and durations to characterize gating kinetics

  • Data analysis approaches:

    • Employ idealization algorithms to detect channel openings and closings

    • Determine single-channel conductance using all-points amplitude histograms

    • Analyze dwell-time distributions to characterize gating kinetics

    • Perform Boltzmann analysis of voltage dependence

  • Advanced analysis parameters to measure:

    ParameterDescriptionAnalytical Method
    Main conductance statePredominant open state conductanceAll-points histogram
    Subconductance statesPartial conductance levelsEvent detection algorithms
    Open probabilityFraction of time in open stateIdealized trace analysis
    Gating kineticsOpening/closing ratesDwell-time histograms
    Voltage sensitivityResponse to transjunctional voltageBoltzmann fitting

For accurate comparison across experiments, maintain consistent recording conditions including temperature, ionic composition, and pH, as these factors significantly impact channel properties.

How does GJC1 interact with other connexins to form heteromeric and heterotypic channels?

Gap junction channels can be formed from different connexin isoforms, creating heteromeric (mixed connexins in one hemichannel) or heterotypic (different connexins in apposed hemichannels) configurations. To study GJC1's interactions:

  • Coexpression systems for heteromeric channels:

    • Cotransfect GJC1 with other connexins in defined ratios

    • Use differentially tagged connexins (e.g., GJC1-GFP and other connexin-RFP)

    • Perform immunoprecipitation to verify physical interaction

    • Analyze channel properties to identify unique heteromeric signatures

  • Heterotypic channel analysis:

    • Culture distinct cell populations expressing different connexins

    • Create mixed cultures and identify cell pairs formed between different cell types

    • Perform dual patch-clamp recordings to characterize rectifying properties

    • Compare with homotypic channels to identify asymmetric voltage-gating

  • Compatibility assessment:

    • Systematically test GJC1 compatibility with other connexin family members

    • Document functional parameters including conductance, gating, and permeability

The double knockout HEK293 cell system is particularly valuable for these studies, as it eliminates the confounding effects of endogenous connexins .

What methodologies are most effective for studying GJC1 in the context of gap junction plaques?

Gap junction plaques are specialized membrane structures containing clustered channels. Studying GJC1 in these contexts requires advanced imaging and biochemical approaches:

  • Super-resolution microscopy techniques:

    • STORM (Stochastic Optical Reconstruction Microscopy)

    • PALM (Photoactivated Localization Microscopy)

    • STED (Stimulated Emission Depletion)

    • These approaches overcome the diffraction limit, revealing plaque organization at nanoscale resolution

  • Biochemical isolation of gap junction plaques:

    • Differential centrifugation to enrich for membrane fractions

    • Detergent resistance assays to isolate junctional complexes

    • Mass spectrometry to identify associated proteins

  • Live-cell imaging approaches:

    • FRAP (Fluorescence Recovery After Photobleaching) to assess lateral mobility

    • Pulse-chase experiments to determine plaque assembly and turnover rates

    • TIRF (Total Internal Reflection Fluorescence) microscopy to visualize membrane dynamics

  • Correlative approaches:

    • Combine functional assessment with structural analysis

    • Link electrophysiological measurements to specific plaque characteristics

    • Integrate findings with computational models of gap junction function

When studying GJC1 localization, researchers should compare patterns with GJA1 (Cx43), as colocalization patterns can provide insights into functional integration within junctional plaques .

What CRISPR-Cas9 strategies are most effective for studying GJC1 function?

CRISPR-Cas9 technology offers powerful approaches for investigating GJC1 function through targeted genetic manipulation:

  • Knockout strategies:

    • Design multiple guide RNAs targeting early exons of GJC1

    • Verify knockout efficiency at genomic (DNA sequencing), transcript (RT-PCR), and protein (Western blot) levels

    • Create isogenic cell lines differing only in GJC1 status for controlled comparisons

    • Consider potential compensatory upregulation of other connexins

  • Knock-in approaches for studying variants:

    • Introduce disease-associated mutations using homology-directed repair

    • Create tagged versions with minimal functional disruption

    • Generate reporter constructs to monitor expression dynamics

  • Base editing and prime editing:

    • For precise nucleotide changes without double-strand breaks

    • Particularly useful for studying single nucleotide variants

    • Reduces off-target effects compared to traditional CRISPR-Cas9

  • Inducible systems:

    • Implement Tet-on/off or similar systems for temporal control

    • Create conditional knockouts for developmental studies

    • Use tissue-specific promoters in animal models

The successful application of CRISPR-Cas9 in generating connexin knockout HEK293 cell lines demonstrates the effectiveness of this approach for gap junction research .

How can disease-associated GJC1 variants be functionally characterized?

Functional characterization of disease-associated GJC1 variants requires systematic analysis of multiple aspects of protein function:

  • Expression and trafficking studies:

    • Compare expression levels between wild-type and mutant using Western blot

    • Analyze subcellular localization using immunofluorescence

    • Quantify surface expression using biotinylation assays

    • Measure protein half-life with cycloheximide chase experiments

  • Channel function assessment:

    • Perform dye transfer assays to assess permeability

    • Use dual patch-clamp to characterize electrophysiological properties

    • Compare voltage-gating properties with wild-type channels

    • Analyze single-channel conductance and gating kinetics

  • Protein interaction studies:

    • Investigate interactions with trafficking machinery

    • Assess oligomerization with other connexins

    • Examine integration into gap junction plaques

  • Cellular phenotype analysis:

    • Measure effects on cell proliferation and migration

    • Assess impact on response to cellular stressors

    • Evaluate tissue-specific consequences in relevant cell types

This approach is similar to that used for studying the cardiac arrhythmia-linked Cx45 mutant R184G, which failed to form functional gap junctions in DKO HEK293 cells and showed impaired localization .

What mass spectrometry approaches are most informative for GJC1 research?

Mass spectrometry (MS) provides powerful insights into GJC1 protein characteristics:

  • PTM identification and quantification:

    • Phosphoproteomics to map phosphorylation sites

    • Glycoproteomics to characterize sugar modifications

    • Ubiquitylome analysis to identify ubiquitination sites

    • SUMO-specific MS approaches for SUMOylation analysis

  • Interaction proteomics:

    • Proximity labeling (BioID, APEX) to identify neighboring proteins

    • Immunoprecipitation coupled with MS (IP-MS) for stable interactions

    • Crosslinking MS (XL-MS) to map structural relationships

    • Label-free quantification to assess interaction dynamics

  • Structural analysis:

    • Native MS to analyze intact complexes

    • Hydrogen-deuterium exchange MS to probe conformational dynamics

    • Limited proteolysis coupled with MS to identify accessible regions

  • Sample preparation considerations:

    • Optimize extraction conditions for membrane proteins

    • Consider detergent compatibility with MS methods

    • Enrich for gap junction plaques when studying in situ interactions

For all MS applications, appropriate controls and careful interpretation are essential, particularly when studying membrane proteins like GJC1.

How can computational modeling enhance understanding of GJC1 channel function?

Computational approaches provide valuable insights into GJC1 structure and function:

  • Structural modeling:

    • Homology modeling based on available connexin structures

    • Molecular dynamics simulations to assess conformational dynamics

    • Pore analysis to predict ion and metabolite permeation

    • Docking studies for potential channel blockers

  • Electrophysiological modeling:

    • Markov models of channel gating

    • Prediction of voltage-dependent behavior

    • Simulation of heteromeric/heterotypic channel properties

    • Integration into tissue-level models

  • Systems biology approaches:

    • Network analysis of GJC1-dependent signaling

    • Multi-scale modeling linking molecular to cellular effects

    • Prediction of emergent properties in coupled cell systems

  • Machine learning applications:

    • Pattern recognition in gap junction plaque formation

    • Prediction of functional effects of mutations

    • Classification of channel subtypes based on functional parameters

When implementing computational approaches, validate predictions with experimental data whenever possible to ensure biological relevance.

What emerging technologies hold promise for advancing GJC1 research?

Several cutting-edge technologies have potential to transform GJC1 research:

  • Advanced imaging technologies:

    • Lattice light-sheet microscopy for 3D visualization of gap junction dynamics

    • Expansion microscopy for nanoscale resolution of gap junction architecture

    • Cryo-electron tomography for in situ structural analysis

    • SMLM (Single Molecule Localization Microscopy) for quantitative analysis of protein distribution

  • Single-cell technologies:

    • Single-cell proteomics to assess cell-specific connexin expression

    • Patch-seq combining electrophysiology with transcriptomics

    • Spatial transcriptomics to map connexin expression in tissue context

    • Multi-omics approaches integrating genomic, transcriptomic, and proteomic data

  • Optogenetic and chemogenetic tools:

    • Light-activatable connexin constructs for temporal control

    • Chemically induced dimerization to control assembly

    • Genetically encoded voltage indicators to visualize gap junction communication

    • Optogenetic control of connexin trafficking

  • Organoid and tissue engineering approaches:

    • 3D cultures recapitulating tissue architecture

    • Microfluidic systems for controlled cell-cell contact

    • Bioprinting technologies for precise spatial arrangement

    • Organ-on-chip models for physiological context

These emerging technologies should be applied alongside established methods to validate findings and expand research possibilities.

How might understanding GJC1 lead to novel therapeutic approaches for associated diseases?

Therapeutic applications based on GJC1 research require addressing several key questions:

  • Therapeutic targeting strategies:

    • Small molecule modulators of channel function

    • Peptide mimetics to interfere with protein interactions

    • Anti-sense oligonucleotides for expression modulation

    • Gene therapy approaches for mutation correction

  • Disease-specific considerations:

    • For Oculodentodigital Dysplasia: targeting developmental pathways affected by GJC1 dysfunction

    • For cardiac arrhythmias: modulating gap junction remodeling

    • For potential cancer applications: context-dependent promotion or inhibition of gap junctional communication

  • Delivery challenges:

    • Tissue-specific targeting of gap junction modulators

    • Strategies for crossing the blood-brain barrier for CNS applications

    • Controlled release systems for sustained effects

    • Cell-type specific expression systems for gene therapy

  • Combination approaches:

    • Integration with current standard-of-care treatments

    • Synergistic targeting of multiple connexins

    • Modulation of both gap junction and hemichannel functions

When developing therapeutic strategies, researchers should consider the extensive intercellular network effects that may result from modulating gap junction function, potentially leading to both beneficial and adverse outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.