Recombinant Human Gap junction gamma-2 protein (GJC2)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Background

Recombinant Human Gap Junction Gamma-2 Protein (GJC2), also known as connexin-47 (Cx47), is a genetically engineered form of the gap junction protein encoded by the GJC2 gene. Gap junctions are intercellular channels facilitating the exchange of ions, metabolites, and small signaling molecules (≤1–2 kDa) between adjacent cells . GJC2 is critical for myelination in the central nervous system (CNS) and peripheral nervous system (PNS), primarily expressed in oligodendrocytes and astrocytes .

Functional Roles

Key functions include:

  • Myelination: Facilitates communication between oligodendrocytes and astrocytes via gap junctions, ensuring myelin sheath formation and maintenance .

  • Ion and metabolite transport: Enables intercellular exchange critical for CNS homeostasis .

  • Lymphatic system regulation: Heterozygous mutations are linked to hereditary lymphedema .

Table 1: Pathogenic GJC2 Mutations and Associated Disorders

MutationDiseaseFunctional ImpactSource
p.Glu260LysSevere PMLD1Disrupts salt bridge network (Asp46-Arg257-Glu260)
Promoter c.-167G>APMLD1 (30% of cases)Reduces SOX10 binding, lowers transcription
Promoter c.-170G>APMLD1Diminishes SOX10-driven promoter activity
p.Val254MetHypomyelinating leukodystrophy (HLD2)Destabilizes connexon assembly
p.Ile33MetSpastic paraplegia type 44 (SPG44)Partial loss of channel function

Mechanistic insights:

  • PMLD-linked mutations (e.g., p.Glu260Lys) disrupt oligodendrocyte-astrocyte communication, impairing myelination .

  • Promoter mutations reduce GJC2 expression by 50–70%, sufficient to cause hypomyelination .

Applications in Biomedical Research

  • Disease modeling: Recombinant GJC2 is used to study PMLD1, SPG44, and hereditary lymphedema pathogenesis .

  • Drug screening: High-throughput assays for compounds restoring gap junction function in GJC2 mutants .

  • Therapeutic development: Gene therapy and small-molecule enhancers targeting oligodendrocyte-specific connexins .

Clinical and Experimental Relevance

Table 2: Disease Associations of GJC2 Dysfunction

DisorderInheritanceKey FeaturesGenetic Basis
PMLD1ARHypomyelination, nystagmus, spasticityBiallelic coding/promoter mutations
SPG44ARChildhood-onset paraplegia, dysarthriaHomozygous p.Ile33Met
Hereditary lymphedemaADLimb swelling, pubertal onsetHeterozygous missense mutations

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
GJC2; GJA12; Gap junction gamma-2 protein; Connexin-46.6; Cx46.6; Connexin-47; Cx47; Gap junction alpha-12 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-439
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GJC2
Target Protein Sequence
MTNMSWSFLTRLLEEIHNHSTFVGKVWLTVLVVFRIVLTAVGGEAIYSDEQAKFTCNTRQ PGCDNVCYDAFAPLSHVRFWVFQIVVISTPSVMYLGYAVHRLARASEQERRRALRRRPGP RRAPRAHLPPPHAGWPEPADLGEEEPMLGLGEEEEEEETGAAEGAGEEAEEAGAEEACTK AVGADGKAAGTPGPTGQHDGRRRIQREGLMRVYVAQLVARAAFEVAFLVGQYLLYGFEVR PFFPCSRQPCPHVVDCFVSRPTEKTVFLLVMYVVSCLCLLLNLCEMAHLGLGSAQDAVRG RRGPPASAPAPAPRPPPCAFPAAAAGLACPPDYSLVVRAAERARAHDQNLANLALQALRD GAAAGDRDRDSSPCVGLPAASRGPPRAGAPASRTGSATSAGTVGEQGRPGTHERPGAKPR AGSEKGSASSRDGKTTVWI
Uniprot No.

Target Background

Function
Gap junctions are clusters of closely packed transmembrane channels (connexons) facilitating low-molecular-weight material diffusion between adjacent cells. They may play a role in central and peripheral nervous system myelination.
Gene References Into Functions
  1. Cx47 mutations trigger varied unfolded protein response (UPR) pathway activation, promoting apoptotic cell death. Inappropriate UPR activation may contribute to Pelizaeus-Merzbacher-Like Disease pathogenesis. PMID: 28712094
  2. GJC2 promoter region mutation screening is recommended for evaluating patients with unexplained hypomyelinating leukodystrophies. PMID: 24374284
  3. GJA1 mutations can cause not only ODD (as previously documented), but also associated lymphoedema. PMID: 23550541
  4. A novel homozygous GJC2 mutation was identified in a patient with Pelizaeus-Merzbacher-like disease. PMID: 23684670
  5. Chromosomal rearrangements near the PLP1 gene, alongside equal frequencies of PLP1 and GJA12/GJC2 mutations, were identified. PMID: 22283455
  6. Most PMLD-linked Cx47 mutants disrupt Cx47/Cx47 and Cx47/Cx43 GJ function in glial networks, potentially contributing to PMLD symptoms. PMID: 23544880
  7. Severe Pelizaeus-Merzbacher-like disease correlates with predicted gap junction channel assembly impairment due to the p.Glu260Lys mutant allele's effect on Cx47. PMID: 22669416
  8. The founder mutation c.-167A>G in the GJC2 promoter region was found in patients with Pelizaeus-Merzbacher and Pelizaeus-Merzbacher-like diseases. PMID: 23142375
  9. Cx47 mutations were identified in individuals with secondary lymphedema post-breast cancer treatment, indicating that altered gap junction function contributes to lymphedema. PMID: 22351697
  10. The GJC2 promoter mutation (c.-167A>G) was identified in patients with Pelizaeus-Merzbacher-like disease, suggesting a founder effect. PMID: 21959080
  11. GJC2 gene mutations are associated with primary lymphoedema. PMID: 21266381
  12. GJC2 mutations are implicated as a cause of primary lymphedema. PMID: 20537300
  13. GJA12 gene mutations were reported in Chinese Pelizaeus-Merzbacher-like disease patients. PMID: 19423250
  14. A novel autosomal recessive hypomyelinating leukodystrophy was identified in the absence of GJA12 mutations. PMID: 20120347
  15. Patients with a homozygous frameshift mutation in GJA12 presented with nystagmus and brain demyelinating disease. PMID: 16969684
  16. GJA12 mutation screening is recommended as an initial genetic test for Pelizaeus-Merzbacher-like disease in patients with consanguineous parents. PMID: 17031678
  17. Cx47 mutants associated with Pelizaeus-Merzbacher-like disease disrupt gap junction coupling between astrocytes and oligodendrocytes. PMID: 17344063
  18. The clinical phenotype of patients with GJA12 mutations is comparable to mild PLP1-related disorders, with better cognition and later axonal degeneration. PMID: 18094336
  19. GJA12 alterations are a rare cause of Pelizaeus-Merzbacher-like disease, even after extensive screening. PMID: 18521858
  20. GJA12/GJC2 mutations can result in a milder phenotype than previously thought. PMID: 19056803
Database Links

HGNC: 17494

OMIM: 608803

KEGG: hsa:57165

STRING: 9606.ENSP00000355675

UniGene: Hs.100072

Involvement In Disease
Leukodystrophy, hypomyelinating, 2 (HLD2); Spastic paraplegia 44, autosomal recessive (SPG44); Lymphedema, hereditary, 1C (LMPH1C)
Protein Families
Connexin family, Gamma-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Expressed in central nervous system, in sciatic nerve and sural nerve. Also detected in skeletal muscles.

Q&A

What is GJC2 and what are its alternative designations in scientific literature?

Gap Junction Gamma-2 (GJC2) is a protein encoded by the GJC2 gene in humans that plays a critical role in both central and peripheral myelination processes. In scientific literature, GJC2 is alternatively referred to as connexin-46.6 (Cx46.6), connexin-47 (Cx47), or gap junction alpha-12 (GJA12) . These multiple designations reflect the protein's classification history within the connexin family. When working with recombinant GJC2, researchers should be aware of these alternative nomenclatures to ensure comprehensive literature searches and proper experimental design. The protein is primarily expressed in the central nervous system, specifically in the brain and spinal cord, where it contributes to the formation of gap junctions between cells .

What is the basic structural organization of the GJC2 protein?

The GJC2 protein exhibits the characteristic structural organization of gap junction connexin family members. This includes 2 extracellular domains, 4 transmembrane domains, and 3 cytoplasmic domains . The protein consists of 439 amino acids with distinct functional regions that contribute to its channel-forming capabilities. The transmembrane domains anchor the protein within the cell membrane, while the extracellular domains mediate the docking between connexins of adjacent cells to form complete gap junction channels . Below is the basic structural information of human GJC2:

Basic Information of GJC2Value
Protein NameGap junction gamma-2 protein
Gene NameGJC2
AliasesConnexin-46.6, Cx46.6, Connexin-47, Cx47, Gap junction alpha-12 protein, GJA12
OrganismHomo sapiens (Human)
UniProt IDQ5T442
Transmembrane Domains4
Length (aa)439

This structural knowledge is essential for researchers designing experiments that target specific domains or functions of the protein .

What cellular functions does GJC2 perform in the nervous system?

GJC2 forms gap junction channels that facilitate intercellular communication by allowing the transport of small molecules, ions, and nutrients between adjacent cells . In the central nervous system, GJC2 plays a crucial role in myelination processes. Gap junctions formed by GJC2 contribute to the establishment and maintenance of myelin sheaths around axons, which are essential for proper nerve signal conduction .

Research methodologies to study these functions typically involve cell culture models expressing GJC2, dye transfer assays to assess gap junction communication, and electrophysiological techniques to measure channel conductance. Knockout or knockdown models can also provide valuable insights into the consequences of GJC2 dysfunction on myelination and neural communication processes .

How can researchers effectively study GJC2 interactions with other connexins in heterotypic gap junctions?

Investigating GJC2 interactions in heterotypic gap junctions requires sophisticated methodological approaches. Researchers should consider co-expression systems where GJC2 is expressed alongside other connexins, particularly its paralog GJC1, to examine their interactions . Techniques such as fluorescence resonance energy transfer (FRET), bimolecular fluorescence complementation (BiFC), and proximity ligation assays (PLA) can be employed to visualize and quantify these interactions in vitro.

For functional assessment of heterotypic channels, dual whole-cell patch-clamp recordings on cell pairs expressing different connexins can be utilized to measure conductance properties. Researchers should be aware that the functional properties of heterotypic channels may differ significantly from homotypic ones, necessitating careful experimental design and controls. Additionally, mutagenesis studies targeting specific domains can help identify critical residues involved in heterotypic compatibility and channel formation .

What approaches can be used to analyze the impact of GJC2 mutations on gap junction functionality?

To analyze the functional consequences of GJC2 mutations, researchers should employ a multi-faceted approach combining molecular, cellular, and physiological techniques. Site-directed mutagenesis can be used to introduce specific mutations identified in patients with GJC2-related disorders into expression constructs . These constructs can then be transfected into appropriate cell models (such as oligodendrocyte cell lines) to assess:

  • Protein expression and localization using immunofluorescence and subcellular fractionation

  • Gap junction plaque formation using electron microscopy or super-resolution imaging

  • Channel permeability using dye transfer assays with molecules of different sizes and charges

  • Electrophysiological properties using patch-clamp recordings

When analyzing results, researchers should consider that mutations may affect different aspects of GJC2 function, including protein trafficking, gap junction assembly, channel gating, or permeability. The severity of functional impairment often correlates with the clinical phenotype, as mutations causing complete loss of function typically result in severe phenotypes like HLD2, while those causing partial loss of function may lead to milder conditions like SPG44 .

How do epigenetic factors influence GJC2 expression in different neural cell populations?

The investigation of epigenetic regulation of GJC2 expression requires sophisticated methodological approaches combining epigenomic profiling with functional validation. Researchers should consider chromatin immunoprecipitation sequencing (ChIP-seq) to identify histone modifications and transcription factor binding sites in the GJC2 promoter and regulatory regions across different neural cell types. DNA methylation patterns can be analyzed using bisulfite sequencing or methylation-specific PCR.

For functional validation, researchers can use epigenetic editing tools (such as CRISPR-dCas9 fused to epigenetic modifiers) to alter specific epigenetic marks at the GJC2 locus and assess the impact on expression. Cell-type-specific analysis is particularly important, as GJC2 expression patterns differ between oligodendrocytes and other neural cells. When interpreting results, researchers should consider the developmental context, as epigenetic regulation of myelination genes, including GJC2, changes during different stages of neural development and maturation .

What methodologies are most effective for studying the role of GJC2 in hypomyelinating leukodystrophies?

Investigating GJC2's role in hypomyelinating leukodystrophies requires integrated approaches spanning molecular, cellular, and in vivo studies. Researchers should consider the following methodological approaches:

  • Patient-derived cells: Fibroblasts from patients with GJC2 mutations can be reprogrammed into induced pluripotent stem cells (iPSCs) and differentiated into oligodendrocytes to study myelination defects in vitro.

  • Animal models: Transgenic mouse models harboring specific human GJC2 mutations can provide insights into disease pathophysiology. Behavioral assessments, electrophysiological recordings, and histopathological analyses should be performed to characterize the phenotype.

  • Imaging techniques: Advanced myelin imaging methods such as diffusion tensor imaging (DTI) and magnetization transfer ratio (MTR) can be applied to both human patients and animal models to quantify myelination deficits.

Homozygous or compound heterozygous defects in the GJC2 gene are responsible for autosomal recessive Pelizaeus-Merzbacher-like disease-1 (PMLD-1) or hypomyelinating leukodystrophy 2 (HLD2) . These conditions typically present in infancy (average onset at 4.3 ± 6.3 months) with symptoms including nystagmus, spasticity, gait deterioration, ataxia, dysarthria, and cognitive impairment . When designing studies, researchers should be aware that HLD2 patients typically exhibit higher motor and cognitive development compared to classical PMD patients, but show more rapid neurological deterioration and higher rates of peripheral neuropathy and seizures .

How can researchers differentiate between GJC2-related phenotypes in experimental models?

Differentiating between various GJC2-related phenotypes (such as HLD2 versus SPG44) requires comprehensive phenotypic characterization and correlation with underlying molecular mechanisms. Researchers should implement a hierarchical approach:

  • Molecular characterization: Analyze the specific GJC2 mutations and their effects on protein expression, trafficking, and channel function using in vitro systems.

  • Cellular phenotyping: Evaluate oligodendrocyte morphology, myelin production, and gap junction formation in cell culture models, with particular attention to differences in partial versus complete loss of function.

  • Electrophysiological assessment: Measure nerve conduction velocities and action potential propagation to assess functional consequences of myelination defects.

  • Histological analysis: Quantify myelin content and structure using electron microscopy and immunohistochemical techniques in both central and peripheral nervous tissues.

This research question is particularly relevant given the documented intrafamilial phenotypic heterogeneity in GJC2-related disorders, where individuals with identical mutations can present with distinct clinical phenotypes ranging from severe HLD2 to milder SPG44 . Researchers should consider that such heterogeneity suggests the involvement of genetic modifiers or environmental factors that influence disease expression. Identifying these factors requires genome-wide association studies or whole exome/genome sequencing approaches in affected families, coupled with functional validation in appropriate model systems .

What are the most appropriate animal models for studying GJC2-related disorders?

Selecting appropriate animal models for GJC2-related disorders requires careful consideration of species-specific differences in myelination processes and the ability to recapitulate human disease phenotypes. Methodological approaches include:

  • Knockout/knockin mouse models: Complete Gjc2 knockout mice can model severe phenotypes like HLD2, while knockin mice carrying specific human mutations can represent various disease subtypes. Researchers should characterize these models through:

    • Behavioral tests assessing motor function, coordination, and cognitive abilities

    • Electrophysiological recordings to measure nerve conduction velocities

    • Histopathological analyses of myelin structure and content

    • Biochemical assessment of myelin protein composition

  • Conditional knockout models: Using Cre-loxP systems, Gjc2 can be selectively deleted in specific cell types or at defined developmental stages to dissect the cell-autonomous effects of GJC2 deficiency in oligodendrocytes versus other neural cells.

  • Zebrafish models: These offer advantages for high-throughput screening and live imaging of myelination processes, though researchers should be aware of differences in zebrafish connexin biology.

When interpreting results from these models, researchers should consider that mouse models may not fully recapitulate the severity spectrum observed in human patients. Additionally, compensatory mechanisms involving other connexins may occur in animal models but not in humans, potentially confounding results .

What expression systems are optimal for producing functional recombinant human GJC2 protein?

Selecting an appropriate expression system for recombinant human GJC2 is critical for obtaining properly folded, functional protein. Methodological considerations include:

  • Mammalian expression systems: HEK293 or CHO cells are preferred for connexin expression as they provide the appropriate cellular machinery for proper folding, post-translational modifications, and trafficking to the plasma membrane. Researchers should use inducible expression systems to control protein levels, as high connexin expression can be cytotoxic.

  • Expression vectors: Constructs should include appropriate tags (such as His, FLAG, or GFP) positioned to avoid interference with channel formation. C-terminal tags are generally preferred as the C-terminus of connexins faces the cytoplasm and is less likely to disrupt channel function.

  • Purification strategy: For membrane proteins like GJC2, detergent solubilization is required. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are recommended to preserve protein structure and function. Affinity chromatography followed by size exclusion chromatography can yield highly pure protein.

  • Functional verification: Following purification, researchers should verify the structural integrity and functionality of recombinant GJC2 using techniques such as circular dichroism spectroscopy, liposome reconstitution assays, and electrophysiological measurements.

When interpreting results, researchers should be aware that the choice of expression system and purification conditions can significantly impact protein conformation and function, potentially affecting downstream applications and experimental outcomes.

How can researchers effectively measure gap junction channel activity of recombinant GJC2 in vitro?

Measuring the channel activity of recombinant GJC2 requires specialized techniques that assess different aspects of gap junction function. Methodological approaches include:

  • Dye transfer assays: Following expression in gap junction-deficient cell lines, researchers can microinject fluorescent dyes of different molecular weights (e.g., Lucifer yellow, propidium iodide) and monitor their spread to adjacent cells. Quantitative analysis should include:

    • Percentage of coupled cells

    • Rate of dye transfer

    • Distance of dye spread over time

  • Double whole-cell patch-clamp: This electrophysiological technique allows direct measurement of junctional conductance between cell pairs expressing GJC2. Researchers should:

    • Measure current-voltage relationships

    • Assess voltage-dependent gating properties

    • Determine unitary conductance of single channels

  • Hemichannel activity assessment: ATP release assays or dye uptake studies can evaluate the function of GJC2 hemichannels prior to complete gap junction formation.

Researchers should include appropriate controls, such as cells expressing known connexin mutants or cells treated with gap junction blockers (e.g., carbenoxolone or octanol). When analyzing results, it's important to consider that GJC2 may form heteromeric channels with other connexins when expressed in cells that endogenously express connexin proteins, potentially confounding the interpretation of channel properties .

What are the key considerations for designing antibodies against specific domains of the GJC2 protein?

Developing effective antibodies against GJC2 requires strategic selection of antigenic regions and validation procedures. Methodological approaches include:

  • Epitope selection: Researchers should target unique regions of GJC2 that distinguish it from other connexins, particularly its paralog GJC1 . The following domains offer distinct advantages:

    • Cytoplasmic loop: Contains family-specific sequences but may be inaccessible in fixed tissues

    • C-terminus: Highly variable among connexins and accessible for antibody binding

    • Extracellular loops: Useful for detecting intact channels but more conserved across connexin family

  • Antibody format: Consider developing both polyclonal antibodies (for higher sensitivity) and monoclonal antibodies (for higher specificity). For detecting native protein conformations, native-conformation antibodies may be developed using intact cells expressing GJC2.

  • Validation strategy: Comprehensive validation should include:

    • Western blotting with recombinant GJC2 and tissue lysates

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence in cells transfected with GJC2 versus untransfected controls

    • Testing in tissues from GJC2 knockout models as negative controls

  • Application-specific considerations: For immunohistochemistry, optimize fixation conditions as overfixation can mask epitopes in membrane proteins. For flow cytometry, consider developing antibodies against extracellular epitopes for live cell detection.

When interpreting results, researchers should be aware of potential cross-reactivity with other connexins due to sequence homology. Antibody performance may also vary between applications, necessitating validation for each specific use case .

What experimental approaches can assess the potential role of GJC2 in neuropsychiatric disorders?

While direct evidence for GJC2's involvement in neuropsychiatric disorders is limited, emerging research suggests gap junction proteins may influence neural circuit synchronization relevant to conditions like schizophrenia. Methodological approaches to investigate this connection include:

  • Genetic association studies: Researchers should design case-control studies examining GJC2 variants in neuropsychiatric disorder cohorts, with particular attention to variants affecting regulatory regions or protein function. Power calculations should account for potentially small effect sizes, as previous studies of other gap junction genes (Cx36, Panx2) did not find significant associations with schizophrenia .

  • Functional genomics: Transcriptomic and proteomic analyses of post-mortem brain tissue from patients with neuropsychiatric disorders can reveal altered GJC2 expression patterns. Single-cell approaches are particularly valuable to identify cell type-specific changes.

  • Electrophysiological studies: Given the role of gap junctions in neural synchronization, researchers should examine how GJC2 manipulation affects neural oscillations, particularly in the gamma frequency band (30-80 Hz), which shows alterations in schizophrenia .

  • Animal behavior models: Conditional GJC2 knockout or knockdown in specific neural circuits can be assessed for behavioral phenotypes relevant to neuropsychiatric disorders, including sensory gating, social interaction, and cognitive flexibility.

When interpreting results, researchers should consider that GJC2 may interact with other gap junction proteins and that its effects on neural circuit function may be region- and context-dependent .

How can researchers effectively study the relationship between GJC2 mutations and phenotypic heterogeneity in clinical populations?

Investigating the relationship between GJC2 mutations and phenotypic heterogeneity requires integrated genetic, clinical, and functional approaches. Methodological considerations include:

  • Comprehensive genotyping: Whole exome or genome sequencing should be performed for patients with suspected GJC2-related disorders to identify both coding and regulatory variants. Researchers should consider analyzing family members, as intrafamilial phenotypic heterogeneity has been documented with identical GJC2 mutations .

  • Detailed phenotyping protocol: Standardized clinical assessments should include:

    • Neurological examination focusing on motor, sensory, and cognitive functions

    • Brain MRI with specific sequences to quantify myelination

    • Nerve conduction studies to assess peripheral nervous system involvement

    • Neuropsychological testing for cognitive profiling

  • Genotype-phenotype correlation: Statistical approaches like regression analysis or machine learning can identify patterns between specific mutations and clinical features across patient cohorts.

  • Functional validation: Patient-derived cells (fibroblasts reprogrammed to iPSCs and differentiated to oligodendrocytes) can be used to assess the functional impact of specific mutations on GJC2 expression, localization, and gap junction formation.

This research approach is particularly relevant given the documented phenotypic spectrum of GJC2-related disorders, ranging from severe HLD2 to milder SPG44 within the same family carrying identical mutations . Researchers should be aware that GJC2 mutations are particularly prevalent in populations with high rates of consanguineous marriages, such as those in Turkey, Pakistan, Saudi Arabia, Iran, and Oman, which account for approximately 60% of all reported GJC2-related neurological cases .

What are the most promising therapeutic approaches targeting GJC2 dysfunction in leukodystrophies?

Developing therapies for GJC2-related disorders requires strategic approaches targeting different aspects of disease pathophysiology. Methodological considerations for researchers include:

  • Gene therapy approaches:

    • AAV-mediated gene delivery can be used to introduce functional GJC2 copies into oligodendrocytes

    • CRISPR-based editing may correct specific mutations in patient-derived cells

    • Researchers should optimize oligodendrocyte-specific promoters and evaluate long-term expression and safety profiles

  • Pharmacological interventions:

    • Small molecules enhancing GJC2 trafficking for mutations causing retention in the endoplasmic reticulum

    • Compounds modulating gap junction gating to enhance residual channel function

    • High-throughput screening assays using dye transfer or electrophysiological readouts can identify candidate molecules

  • Cell-based therapies:

    • Transplantation of oligodendrocyte precursor cells expressing functional GJC2

    • Evaluation of migration, differentiation, and myelination capacity in animal models

    • Assessment of functional recovery through electrophysiological and behavioral measures

When designing these approaches, researchers should consider the developmental timing of intervention, as early treatment before irreversible axonal damage occurs may be critical for therapeutic success. Additionally, combination therapies targeting both GJC2 function and downstream pathways affecting myelin maintenance may provide synergistic benefits .

How can integrated multi-omics approaches advance our understanding of GJC2 biology?

Integrating multiple omics technologies offers powerful opportunities to comprehensively understand GJC2 biology in health and disease. Methodological approaches include:

  • Multi-level omics integration:

    • Genomics: Identify regulatory elements and genetic variants affecting GJC2 expression

    • Transcriptomics: Analyze cell-type-specific expression patterns and alternative splicing

    • Proteomics: Characterize the GJC2 interactome and post-translational modifications

    • Metabolomics: Identify metabolites transported through GJC2 channels

  • Systems biology approaches:

    • Network analysis to position GJC2 within oligodendrocyte differentiation and myelination pathways

    • Mathematical modeling of gap junction communication dynamics

    • Integration with single-cell data to capture cellular heterogeneity

  • Spatial biology techniques:

    • Spatial transcriptomics to map GJC2 expression across brain regions

    • Proximity labeling approaches to identify region-specific protein interactions

    • Correlative light and electron microscopy to link molecular composition with ultrastructural features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.