Recombinant Human Gastrin/cholecystokinin type B receptor (CCKBR)

Shipped with Ice Packs
In Stock

Description

Production and Applications

Recombinant CCKBR is synthesized using heterologous expression systems:

SystemPurificationApplicationsSources
E. coliSDS-PAGE >85%Structural studies, ligand-binding assays
Mammalian CellsHis-tag/GSTFunctional assays (e.g., G-protein coupling, intracellular signaling)
YeastAffinity chromatographyCell-free systems for receptor-ligand interaction studies

Recombinant CCKBR is used to:

  • Map ligand-receptor interactions: Structural studies reveal key residues (e.g., H207ECL2, R3566.55) critical for gastrin binding .

  • Test antagonists: Compounds like L-365,260 and YM 022 inhibit CCKBR signaling in cancer models .

  • Study cancer mechanisms: CCKBR overexpression correlates with gastric and pancreatic cancer progression .

Role in Cancer Research

CCKBR is implicated in oncogenesis through multiple pathways:

Cancer TypeEffectMechanismSources
GastricPromotes proliferation, inhibits apoptosisActivates β-catenin/Tcf-4, upregulates c-myc and growth factor receptors
PancreaticStimulates tumor growth, predicts survival outcomesGastrin-induced ERK1/2 and NF-κB pathways
ColorectalLinked to metastasis via angiogenesisConstitutive activation of Src/VEGF pathways

Key Findings:

  • GKN1 suppression: Gastrin-induced CCKBR expression is inhibited by gastrokine 1 (GKN1), reducing gastric cancer cell proliferation .

  • Genetic variants: Polymorphisms in CCKBR (e.g., SNP rs187744) predict survival in pancreatic cancer .

Therapeutic Targeting

CCKBR antagonists are under investigation for treating cancers and neurological disorders:

AntagonistMechanismEfficacy in ModelsSources
L-365,260Competitive inhibitionReduces gastric tumor growth in xenografts
YM 022High-affinity bindingInhibits ERK1/2 and NF-κB pathways
ProglumideWeak antagonistLimited clinical benefit in gastric cancer

Challenges:

  • Off-target effects due to CCKBR’s role in CNS (anxiety, satiety).

  • Rapid degradation of peptide antagonists, necessitating non-peptide alternatives .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
CCKBR; CCKRB; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-447
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL PDEDPPTPSIASLSRLSYTTISTLGPG
Uniprot No.

Target Background

Function
The recombinant human Gastrin/Cholecystokinin type B receptor (CCKBR) is a receptor for gastrin and cholecystokinin. CCK-B receptors are widely distributed throughout the central nervous system, where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its effects through G protein coupling, activating a phosphatidylinositol-calcium second messenger system. Isoform 2 exhibits constitutive activation and may regulate cancer cell proliferation independently of gastrin.
Gene References Into Functions
  1. Low serum gastrin correlates with increased risk of ER(+) breast cancer development. CCKBR/ERK/P65 signaling appears tumor-suppressive in ER(+) breast cancer, suggesting therapies should focus on restoring, rather than inhibiting, this pathway activity. PMID: 30115027
  2. High CCK2R expression is associated with cancer. PMID: 26910279
  3. Z-360 exhibits an anti-tumor effect by reducing anti-apoptosis factors through CCK2R blockade. PMID: 28739697
  4. High CCK-BR expression is associated with gastric cancer. PMID: 27518872
  5. No significant link exists between nuclear CCK2R expression and clinicopathological characteristics in a Taiwanese colon cancer cohort. PMID: 26508021
  6. The c.811+32C>A variant in the CCKBR gene does not significantly impact pancreatic cancer risk or survival in a Hungarian cohort. PMID: 26646278
  7. CCK2 receptors show high cytoplasmic expression in cancerous cells, contrasting with low levels in normal tissues. PMID: 26520651
  8. CCK-BR SNP predicts survival and warrants investigation as a potential genetic biomarker for pancreatic cancer risk. PMID: 25469546
  9. Gastrin, a CCK2R agonist, stimulates GLP-1 secretion, likely through increased proglucagon and PCSK1 expression. PMID: 25601282
  10. CCK2R plays a promoting role in gastrointestinal stromal tumor (GIST) tumourigenesis, particularly in gastric tumors. PMID: 22786615
  11. The gastrin receptor is a promising tumor cell surface target for prostate cancer-specific imaging. PMID: 24211650
  12. DeltaFosB induction in the prelimbic area, selectively observed in susceptible mice after chronic social defeat stress, partly occurs through CCK-B receptor induction. PMID: 24623766
  13. Certain CCKBR polymorphisms may contribute to suicidal behavior predisposition in bipolar disorder. PMID: 23890582
  14. Gastric mucosal injury from H. pylori infection disrupts the pH barrier, potentially inducing gastrin receptor expression through pH changes. PMID: 23053898
  15. CCK2R-mediated COX-2 upregulation via the JAK2/STAT3/PI3K/Akt pathway is implicated in gastrin's proliferative effect on human gastric cancer cells. PMID: 23376640
  16. Cholecystokinin 2 receptor (CCK2R) mutations may promote tumorigenesis through deregulated receptor activity, highlighting the potential of CCK2R inhibitors. PMID: 22516348
  17. The CCK-BR plays a significant role in regulating growth and apoptosis in pancreatic cancer. PMID: 22442157
  18. A novel splice variant acts as a dominant negative, affecting CCK2R membrane density and potentially impacting the pathophysiology of certain tumors and their in vivo CCK2R targeting. PMID: 22040601
  19. A single nucleotide polymorphism in the cholecystokinin-B receptor affecting splicing predicts survival in pancreatic cancer. PMID: 22277584
  20. Proximal DNA elements within the human gastrin gene promoter mediate interactions between JunD (inducing gastrin gene expression) and menin (suppressing JunD-mediated activation). PMID: 21852362
  21. Genetic polymorphisms in the cholecystokinin B receptor may contribute to antipsychotic-induced weight gain in schizophrenia patients. PMID: 20732371
  22. Agonist-mediated regulation of membrane cholecystokinin-2 receptor allows for the classification of partial agonists as biased agonists. PMID: 21156802
  23. A positive-feedback loop exists where gastrin, acting via the CCK2 receptor, increases its own expression. PMID: 20932834
  24. The CCK(2) splice variant with intron 4 retention (Ri4sv) is a marker for specific gastrointestinal and lung tumors. PMID: 19627395
  25. The cholecystokinin 2 receptor allele with 21 CT repeats is associated with multiple chemical sensitivity. PMID: 20185366
  26. ACAT/cholesterol esterification signaling is a novel pathway for CCK2R, contributing to tumor cell proliferation and invasion. PMID: 19502590
  27. Gastrin and cholecystokinin 2 (CCK(2)) receptor splice variants are upregulated in human colonic adenomas, potentially contributing to tumor growth and progression. PMID: 19697327
  28. A misspliced cholecystokinin-B/gastrin receptor in pancreatic carcinoma involves reduced cellular U2AF35 and a suboptimal 3'-splicing site, leading to intron 4 retention. PMID: 11830556
  29. hGARE is a potential candidate target gene in microsatellite instability tumorigenesis. PMID: 11896205
  30. CCKBR plays a role in activating protein kinase D2. PMID: 12058027
  31. Hypergastrinemia may promote proliferation of human colonic adenomas expressing non-truncated CCK-2 receptor isoforms. PMID: 12189558
  32. CCKBR regulates cell-cell and cell-substrate adhesion, potentially contributing to carcinoma progression. PMID: 12400008
  33. CCK-B receptor-mediated activation of the hypothalamic-pituitary-adrenal axis shows relative resistance to cortisol feedback inhibition. PMID: 12510010
  34. CCKBR is induced by oncogenic ras in LoVo and Colo320HSR colon cancer cell lines. PMID: 12761477
  35. Cholecystokinin-A and -B receptor polymorphisms show no correlation with hallucinations in Parkinson's disease. PMID: 12777967
  36. A constitutively active CCK2R mutant exhibits a high tumorigenic effect, suggesting a potential role for CCK2R in human cancer. PMID: 12955087
  37. CCK2R has physiological roles in calcitonin secretion and gene expression, as well as a pathophysiological role in medullary thyroid carcinoma proliferation. PMID: 14759564
  38. CCK exerts secretagogue action on human ZG cells through CCK2-Rs coupled to the adenylate cyclase/protein kinase A signaling cascade. PMID: 15001623
  39. The CCKB receptor gene may be implicated in suicide completion, with highest gene expression observed in the cerebellum, cingulate gyrus, and prefrontal cortex. PMID: 15036586
  40. A gastrin/CCK-B receptor autocrine or paracrine pathway may play a role in gastric cancer progression. PMID: 15040018
  41. CCK2i4svR, a cholecystokinin-2 receptor splice variant, is involved in agonist-independent activation of Src tyrosine kinase. PMID: 15292208
  42. Genetic variation in the CCK B receptor system may contribute to panic disorder pathogenesis. PMID: 15354400
  43. The MEK1/ERK1/2 pathway links the CCK2 receptor to Egr-1 nuclearization and DNA binding. PMID: 15611055
  44. Interspecies polymorphism analysis in human and rat cholecystokinin receptor-2 reveals its effects on the cholecystokinin binding site. PMID: 15817487
  45. Photoaffinity labeling of the type B CCK receptor indicates that the peptide-binding domain includes receptor loop and amino-terminal tail regions at the extracellular surface. PMID: 15850403
  46. Human normal, inflammatory, and malignant gastric tissues express both classical and alternative splicing cholecystokinin-B/gastrin receptor genes. PMID: 15989082
  47. Gastric cancer tissues frequently express the gastrin/CCKB receptor, stimulating the growth of receptor-positive cancer cells. PMID: 16012719
  48. The CCK2 gastrin receptor may have a role in leukemia. PMID: 16142371
  49. Gastrin exhibits antiproliferative and proapoptotic effects on human colon cancer cells expressing the wild-type CCK2 receptor. PMID: 16143134
  50. High gastrin and gastrin receptor expression rates (approximately half) are observed in gastric carcinoma tissues, with an association between their expressions. PMID: 16228228
Database Links

HGNC: 1571

OMIM: 118445

KEGG: hsa:887

STRING: 9606.ENSP00000335544

UniGene: Hs.203

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the smal

Q&A

What is the genomic organization of the human CCKBR gene?

The human gastrin/CCKB receptor gene contains a 1356-bp open reading frame consisting of five exons interrupted by four introns and is assigned to human chromosome 11p15.4. A region of exon 4, which encodes a portion of the putative third intracellular loop, appears to be alternatively spliced to yield two different mRNAs. The long isoform (452 amino acids) contains the pentapeptide sequence Gly-Gly-Ala-Gly-Pro, while the short isoform (447 amino acids) lacks this sequence. These receptor isoforms may contribute to functional differences in gastrin- and CCK-mediated signal transduction .

How does CCKBR distribution differ between tissues?

CCKBR is a type B gastrin receptor with high affinity for both sulfated and nonsulfated CCK analogs. It is found principally in the central nervous system and the gastrointestinal tract. In the stomach, CCKBR expression has been identified in parietal cells and chromogranin A+ (ChgA+) ECL cells in the corpus, but not in gastric intrinsic factor+ (GIF+) chief cells. In the gastric antrum, CCKBR+ cells are frequently detected as single cells positioned just above the Lgr5+ cells at the base of the gland .

What methodologies are recommended for measuring CCKBR ligands in biological samples?

For accurate measurement of gastrin and CCK, specific radioimmunoassays are recommended to avoid cross-reactivity issues. For gastrin measurement, an antiserum (no. 2604) directed against the C-terminus of gastrin-17 can be used, which binds all C-terminally amidated gastrins (-14, -17, -34, -52 and -71) with equimolar potency but does not cross-react with CCK. For CCK measurement, an antiserum (no. 92128) that binds bioactive forms of CCK (-8, -22, -33 and -58) with equal potency without cross-reactivity with gastrin is recommended. Quality control is essential; in reference studies, the coefficient of variation for these assays was 32% for gastrin and 23% for CCK .

How does CCKBR contribute to gastric epithelial stem cell identity?

CCKBR defines antral stem cells at position +4, which overlaps with an Lgr5neg or low cell population but is distinct from typical antral Lgr5high stem cells. Using CCK2R-CreERT mice crossed with reporter mice for lineage tracing experiments, researchers have demonstrated that CCK2R+ recombined cells expand rapidly to trace whole antral glands within 10 days after induction, with traced glands persisting beyond 12 months. This indicates that CCK2R labels antral stem cells with long-term self-renewal capacity .

What techniques can be used to isolate and culture CCKBR+ gastric stem cells?

CCKBR+ gastric stem cells can be isolated using fluorescence-activated cell sorting (FACS) from CCK2R-CreERT reporter mice. These cells can then be cultured in a three-dimensional in vitro system that supports the growth and differentiation of gastric organoids. This system typically includes growth factors such as EGF, Noggin, and R-spondin. For experimental manipulation of CCK2R signaling, researchers can utilize selective CCK2 agonists (e.g., Gastrin I human, Caerulein) or antagonists (e.g., LY 288513, L-365,260, YM 022, CI 988) .

How do progastrin and CCK2R interact to regulate gastric stem cell dynamics?

Progastrin, an incompletely cleaved precursor of gastrin secreted by G-cells in the gastric antrum, can interconvert Lgr5neg or low CCK2R+ cells into Lgr5high cells. This conversion has been demonstrated in Lgr5-GFP;hGAS (human progastrin-overexpressing) double transgenic mice, where the expression of CCK2R in the Lgr5-GFP+ population is markedly increased. This suggests that progastrin can activate and expand CCK2R+ stem cells, potentially contributing to gastric gland homeostasis and carcinogenesis. Importantly, this interconversion is specific to undifferentiated CCK2R+ stem cells, as ChgA+ endocrine cells do not become Lgr5-positive even with progastrin overexpression .

What are the implications of CCKBR alternative splicing in gastric cancer research?

Alternative splicing of CCKBR, particularly in exon 4 encoding the third intracellular loop, results in two receptor isoforms that may have different signaling properties. A misspliced transcript variant, including an intron, has been observed specifically in colorectal and pancreatic tumor cells. Research should consider which isoform is being studied, as these structural differences may contribute to functional variations in gastrin- and CCK-mediated signal transduction. When designing experiments to target CCKBR in cancer cells, researchers should account for potential isoform-specific responses to agonists and antagonists .

How can CCKBR lineage tracing be optimized for gastric stem cell research?

For optimal lineage tracing of CCKBR+ cells, researchers should consider the following methodological approach:

  • Generate CCK2R-CreERT mice using BAC transgenesis to ensure faithful recombination that reflects the endogenous expression pattern

  • Cross with appropriate reporter mouse lines (e.g., Rosa26-LSL-tdTomato)

  • Optimize tamoxifen dosing (1-6 mg has been successful, with lower doses reducing potential toxicity)

  • Analyze traced cells at multiple time points (24 hours to 12+ months)

  • Perform co-immunostaining with markers for differentiated cell types to assess the multilineage differentiation potential

This approach has successfully demonstrated that CCK2R+ cells can trace whole antral glands that persist long-term, confirming their stem cell identity .

What is the epidemiological evidence linking CCKBR signaling to gastric cancer risk?

Studies have shown that elevated serum levels of gastrin, a CCKBR ligand, are associated with increased risk of gastric non-cardia adenocarcinomas (GNCA). In a case-control study nested within the Alpha-Tocopherol, Beta-Carotene Cancer Prevention (ATBC) Study, individuals with high gastrin levels (Q4 vs Q1) had a significantly increased risk of GNCA (fully adjusted OR: 1.92; 95% CI: 1.21, 3.05). This association became stronger after additional adjustment for CCK (Q4 vs Q1: OR: 2.56; 95% CI: 1.52, 4.30). Furthermore, serum gastrin was significantly associated with risk of gastric carcinoids (age-adjusted continuous model OR: 4.67; 95% CI: 2.67, 8.15), though the number of carcinoid cases was small. The role of CCK in cancer risk appears less clear, with inconsistent associations observed .

How does progastrin-CCKBR signaling contribute to gastric carcinogenesis?

Progastrin appears to promote gastric carcinogenesis through several CCKBR-dependent mechanisms:

  • Interconversion of Lgr5neg or low CCK2R+ cells into Lgr5high cells

  • Expansion of CCK2R+ cell numbers

  • Promotion of gland fission

  • Enhancement of carcinogenesis in response to chemical carcinogens (e.g., MNU)

These effects can be attenuated by pharmacological inhibition or genetic ablation of CCKBR, suggesting that progastrin-CCKBR signaling represents a potential therapeutic target for gastric cancer prevention and treatment. Researchers should consider these mechanisms when designing studies to investigate gastric carcinogenesis and when developing targeted therapies .

What experimental models are recommended for studying CCKBR-mediated gastric carcinogenesis?

The following experimental models have proven valuable for investigating CCKBR in gastric cancer:

Model TypeDescriptionApplicationsLimitations
CCK2R-CreERT miceBAC transgenic mice expressing tamoxifen-inducible Cre recombinase under CCK2R promoterLineage tracing, genetic manipulation of CCK2R+ cellsMay not fully recapitulate human CCK2R expression patterns
Lgr5-GFP-CreERT miceTransgenic mice labeling Lgr5+ stem cellsIdentification of stem cell populations, lineage tracingLabels only a subset of gastric stem cells
hGAS miceHuman progastrin-overexpressing transgenic miceStudy effects of progastrin on gastric epitheliumConstitutive overexpression may not reflect physiological conditions
MNU-induced carcinogenesisChemical carcinogen model in miceStudy factors promoting or inhibiting carcinogenesisMay not reflect all aspects of human gastric cancer
3D organoid cultureIn vitro culture of gastric stem cellsMechanistic studies, drug screeningLacks immune components and stromal interactions

Combined approaches using these models provide complementary insights into CCKBR function in normal and malignant gastric tissue .

How can researchers distinguish between CCKBR and CCKAR in experimental settings?

To distinguish between CCKBR (CCK2R) and CCKAR (CCK1R) in experimental settings, researchers should consider:

  • Using selective agonists:

    • Gastrin I (human) as a selective CCK2 agonist

    • Caerulein as a CCK agonist that acts on both receptors

  • Using selective antagonists:

    • LY 288513, L-365,260, YM 022, and CI 988 as selective CCK2 antagonists

    • Specific CCK1R antagonists for comparison studies

  • Employing molecular techniques:

    • Receptor-specific antibodies for immunohistochemistry and Western blotting

    • Specific qPCR primers for distinguishing receptor subtypes

    • CRISPR-Cas9 targeting specific receptor genes for knockout studies

These approaches help ensure that observed effects are attributed to the correct receptor subtype .

What considerations should be made when designing radioimmunoassays for CCKBR ligands?

When designing radioimmunoassays for CCKBR ligands, researchers should consider:

  • Cross-reactivity: Since gastrin and CCK comprise a family of gastrointestinal hormones that share an identical carboxyl-terminal pentapeptide sequence, it has been historically difficult to measure CCK and avoid cross-reactivity with gastrin. Use highly specific antisera: antiserum no. 2604 for gastrin and antiserum no. 92128 for CCK.

  • Quality control: Include blinded quality control samples (10% of total samples) from a single serum pool within each batch to calculate coefficients of variation.

  • Sample volume considerations: Prioritize measurements based on sample volume availability.

  • Detection of multiple forms: Ensure the assay detects all bioactive forms of the hormone (for gastrin: -14, -17, -34, -52 and -71; for CCK: -8, -22, -33 and -58).

  • Statistical analysis: Account for batch effects and interassay variability when analyzing results .

What are the key considerations when interpreting CCKBR expression data across different tissues?

When interpreting CCKBR expression data across different tissues, researchers should consider:

  • Cell type heterogeneity: CCKBR is expressed in specific cell populations (e.g., parietal cells, ECL cells, +4 antral stem cells) that may constitute a small fraction of the total tissue.

  • Regional variations: Expression patterns differ between gastric corpus and antrum, and between gastrointestinal tract and central nervous system.

  • Alternative splicing: The presence of alternatively spliced isoforms may affect detection depending on the primers or antibodies used.

  • Pathological states: CCKBR expression may be altered in disease states, particularly in gastrointestinal cancers.

  • Species differences: Expression patterns may differ between human samples and animal models.

Single-cell RNA sequencing, immunohistochemistry with cell type-specific markers, and in situ hybridization can help resolve these complexities and provide more accurate interpretation of CCKBR expression data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.