Recombinant Human GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1,2-mannosyltransferase (ALG11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ALG11; GT8; GDP-Man:Man(3GlcNAc(2-PP-Dol alpha-1,2-mannosyltransferase; Asparagine-linked glycosylation protein 11 homolog; Glycolipid 2-alpha-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAAGERSWCLCKLLRFFYSLFFPGLIVCGTLCVCLVIVLWGIRLLLQRKKKLVSTSKNGK NQMVIAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDVNVNGQQILEGAFRRF NIRLIHPVQFVFLRKRYLVEDSLYPHFTLLGQSLGSIFLGWEALMQCVPDVYIDSMGYAF TLPLFKYIGGCQVGSYVHYPTISTDMLSVVKNQNIGFNNAAFITRNPFLSKVKLIYYYLF AFIYGLVGSCSDVVMVNSSWTLNHILSLWKVGNCTNIVYPPCDVQTFLDIPLHEKKMTPG HLLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVLIGGCRNKDDELRVNQLRRL SEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSG GPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFE VTFLSSVEKLFK
Uniprot No.

Target Background

Function
Recombinant Human GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase (ALG11) is a mannosyltransferase crucial in the final steps of Man5GlcNAc(2)-PP-dolichol core oligosaccharide synthesis on the cytoplasmic face of the endoplasmic reticulum. Its function is to catalyze the addition of the fourth and fifth mannose residues to the dolichol-linked oligosaccharide chain.
Gene References Into Functions
  1. Analysis suggests differing transcriptional control mechanisms between murine and human ALG11. PMID: 25036826
  2. Following identification of a congenital disorder of glycosylation-Ip index patient, this study describes three additional cases of ALG11 deficiency. PMID: 22213132
  3. Endoplasmic mannosyltransferase hALG11 deficiency leads to congenital disorders of glycosylation. PMID: 20080937
Database Links

HGNC: 32456

OMIM: 613661

KEGG: hsa:440138

STRING: 9606.ENSP00000430236

UniGene: Hs.512963

Involvement In Disease
Congenital disorder of glycosylation 1P (CDG1P)
Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 4 subfamily
Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biological function of ALG11 in the N-glycosylation pathway?

ALG11 functions as a GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase that operates in the biosynthetic pathway of dolichol-linked oligosaccharides, which serve as the glycan precursors employed in protein asparagine (N)-glycosylation . Specifically, ALG11 catalyzes the addition of the fourth and fifth α1,2-linked mannose residues to the growing oligosaccharide chain on the cytosolic face of the endoplasmic reticulum (ER) . This step is crucial in generating the Man5GlcNAc2-PP-Dol intermediate, which subsequently flips into the ER lumen for further processing .

The assembly of dolichol-linked oligosaccharides involves a sequential process that begins on the cytosolic side of the ER membrane and culminates in the lumen. In this process, two N-acetyl-glucosamines (GlcNAc) and five mannoses (Man) are first attached to dolichol pyrophosphate on the cytosolic face, followed by the addition of seven more sugars (four mannoses and three glucoses) in the lumen before transfer to nascent proteins by oligosaccharyltransferase . The specific role of ALG11 in this pathway involves adding the fourth and fifth α1,2-linked mannoses, which are critical for proper oligosaccharide structure and subsequent glycoprotein function .

What are the clinical manifestations of ALG11 deficiency?

ALG11 deficiency results in a rare inherited metabolic disorder known as ALG11-CDG (Congenital Disorder of Glycosylation, formerly CDG-1p) . This condition is characterized by prominent neurological symptoms including seizures, developmental delay, and microcephaly . As of recent data, only 17 cases of ALG11-CDG have been documented worldwide, indicating its rarity .

The pathophysiology of ALG11-CDG stems from impaired N-glycosylation due to reduced activity of the ALG11 enzyme. This results in hypoglycosylation of numerous proteins, including GP130, which has been identified as a hyperglycosylated protein affected in this disorder . The broad impact on protein glycosylation explains the multi-system nature of this condition, though neurological manifestations tend to predominate in the clinical presentation.

What is known about the structure and topology of ALG11?

ALG11 is an ER membrane protein with its catalytic domains facing the cytosol . This orientation is essential for its function, as it utilizes GDP-mannose from the cytosolic compartment as the sugar donor for mannosylation reactions . The enzyme is classified as a glycosyltransferase that specifically catalyzes the formation of α1,2-glycosidic linkages in the growing oligosaccharide chain .

The ALG11 gene is located on chromosome 13q14.3 in humans . The protein contains functional domains that are conserved across species, reflecting the evolutionary importance of this enzyme in the N-glycosylation pathway. While detailed crystal structures of human ALG11 have not been extensively characterized in the available search results, research indicates that specific mutations affecting conserved regions of the protein, such as those in exon 4 (p.G436V and p.R468H), can significantly impact protein stability and function .

What cofactors and conditions are required for optimal ALG11 enzymatic activity?

ALG11 requires GDP-mannose as the essential sugar donor substrate for its mannosyltransferase activity . The enzyme functions optimally in the context of the ER membrane environment, where it interacts with other components of the N-glycosylation machinery. The sequential addition of mannose residues by ALG11 follows the action of Alg1 (which adds the first β1,4-linked mannose) and Alg2 (which adds the second and third α1,6- and α1,3-linked mannoses) .

The enzymatic activity of ALG11 depends on proper membrane insertion and orientation, with the catalytic domain accessible to cytosolic GDP-mannose. While specific pH and ionic requirements are not detailed in the available search results, the ER environment typically provides the optimal conditions for ALG11 function. Additionally, the proper functioning of preceding enzymes in the pathway (Alg1 and Alg2) is necessary to generate the appropriate substrate for ALG11 .

What techniques are effective for evaluating ALG11 enzymatic activity?

Assessing ALG11 enzymatic activity typically involves measuring the transfer of mannose residues from GDP-mannose to the Man3GlcNAc2-PP-Dol substrate. While specific details of these assays are not provided in the search results, standard approaches for glycosyltransferase activity analysis would apply. These often include:

  • Radiometric assays using GDP-[³H]mannose to track the incorporation of radiolabeled mannose into the lipid-linked oligosaccharide.

  • HPLC or mass spectrometry-based methods to analyze the oligosaccharide products before and after incubation with recombinant ALG11.

  • Functional complementation assays in yeast or mammalian cells with ALG11 deficiency, where restoration of normal glycosylation patterns indicates enzymatic activity.

For in vitro analysis, hypoglycosylation of glycoproteins like GP130 can serve as a functional readout of ALG11 activity, as demonstrated in recent research . The decreased stability of mutant ALG11 protein variants can be assessed using standard protein stability assays and Western blotting techniques .

What genetic testing approaches are used to identify ALG11 variants?

Trio whole-exome sequencing (WES) has proven effective for identifying pathogenic variants in the ALG11 gene, as demonstrated in recent clinical cases . This approach allows for the detection of novel variants and their inheritance patterns within families. Following WES, Sanger sequencing is typically employed to confirm the identified variants .

The performance metrics of high-quality, clinical-grade next-generation sequencing (NGS) assays for analyzing genes like ALG11 demonstrate excellent sensitivity and specificity. According to available data, the sensitivity for detecting single nucleotide variants is 99.89% with specificity >99.9999% . For insertions, deletions, and indels of various sizes, detection sensitivity ranges from 99.13% to 99.2% . The table below summarizes the performance metrics of NGS for variant detection:

|Variant Type|Sensitivity % (TP/(TP+FN))|Specificity %|
|--|--|
|Single nucleotide variants|99.89% (99,153/99,266)|>99.9999%|
|Insertions, deletions and indels (1-10 bps)|99.2% (7,745/7,806)|>99.9999%|
|Insertions, deletions and indels (11-50 bps)|99.13% (2,524/2,546)|>99.9999%|
|Copy number variants (1 exon level deletion, heterozygous)|100% (20/20)|NA|
|Copy number variants (1 exon level deletion, homozygous)|100% (5/5)|NA|

These metrics highlight the effectiveness of modern genetic testing methods for accurately identifying variants in ALG11 and other genes associated with congenital disorders of glycosylation .

What types of pathogenic variants have been identified in the ALG11 gene?

Recent research has expanded the spectrum of known pathogenic variants in the ALG11 gene. A notable example is the identification of novel compound heterozygous variants c.1307G>T (p.G436V) and c.1403G>A (p.R468H) within exon 4 of the ALG11 gene in a Chinese family . These variants were inherited in an autosomal recessive pattern, with one variant from each parent .

Functional analysis of these variants revealed decreased stability of the mutant protein and concurrent hypoglycosylation of GP130, a hyperglycosylated protein . This finding underscores how ALG11 variants can impair protein function and subsequently affect the glycosylation of target proteins, leading to the clinical manifestations observed in ALG11-CDG.

While the specific mechanisms by which these variants affect ALG11 function may vary, they generally result in reduced enzymatic activity, leading to impaired mannose addition to the growing oligosaccharide chain. This disruption in the early steps of N-glycosylation has cascading effects on downstream glycoprotein processing and function.

How are genotype-phenotype correlations established in ALG11-CDG?

The severity and specific manifestations of ALG11-CDG may vary depending on the nature of the pathogenic variants and their impact on residual enzyme activity. Functional studies comparing different ALG11 variants can help establish these correlations by quantifying:

  • The degree of protein stability reduction

  • Residual enzymatic activity

  • Extent of hypoglycosylation of target proteins

  • Cellular consequences in patient-derived or engineered cell models

As illustrated in a recent case study, in vitro functional analysis of novel ALG11 variants provided valuable insights into their pathogenicity by demonstrating decreased protein stability and associated hypoglycosylation effects . Such functional characterization is essential for establishing reliable genotype-phenotype correlations and enhancing our understanding of the molecular mechanisms underlying ALG11-CDG.

How can CRISPR/Cas9 technology be applied to study ALG11 function?

CRISPR/Cas9 technology offers powerful approaches for investigating ALG11 function in cellular and animal models. While not explicitly described in the search results, logical applications of this technology would include:

  • Generation of ALG11 knockout or knockdown models to study complete or partial loss of function

  • Introduction of specific patient-derived mutations to create cellular models of ALG11-CDG

  • Tagging endogenous ALG11 with fluorescent markers to study subcellular localization and dynamics

  • Creation of conditional ALG11 knockout models to study tissue-specific effects

When designing CRISPR/Cas9 experiments targeting ALG11, researchers should consider the gene's structure and sequence. The ALG11 gene is located on chromosome 13q14.3, and its genomic coordinates are chr13:52586534-52607736 (GRCh37/hg19) or chr13:52012398-52033600 (GRCh38/hg38) . The MANE Select Transcript is NM_001004127.3/ENST00000521508.2 , which should be used as the reference sequence for guide RNA design.

What strategies can improve the expression and purification of recombinant ALG11?

Expressing and purifying functional recombinant ALG11 presents challenges due to its nature as an ER membrane protein. While specific protocols are not detailed in the search results, effective strategies would typically include:

  • Expression systems selection: Mammalian expression systems (HEK293, CHO cells) may provide the most native environment for proper folding and post-translational modifications of human ALG11. Alternatively, insect cell systems (Sf9, Hi5) can offer advantages for membrane protein expression.

  • Construct optimization:

    • Inclusion of appropriate affinity tags (His, FLAG, etc.) for purification

    • Consideration of fusion partners to enhance solubility

    • Testing truncated constructs that retain catalytic domains while removing transmembrane regions

    • Codon optimization for the chosen expression system

  • Solubilization and purification approaches:

    • Careful selection of detergents compatible with membrane protein extraction while preserving enzymatic activity

    • Nanodisc or liposome reconstitution to maintain native-like membrane environment

    • Affinity chromatography followed by size exclusion or ion exchange chromatography

  • Activity preservation:

    • Inclusion of stabilizing agents in purification buffers

    • Maintaining appropriate pH and ionic conditions

    • Addition of relevant cofactors (GDP or GDP-mannose)

Success in obtaining active recombinant ALG11 would significantly advance structural studies and enzymatic characterization, contributing to a deeper understanding of its catalytic mechanism and potential development of therapeutic approaches for ALG11-CDG.

What are the current diagnostic approaches for ALG11-CDG?

Diagnosis of ALG11-CDG relies on a combination of clinical evaluation, biochemical testing, and genetic analysis. Recent advances highlight whole-exome sequencing (WES) as a first-tier genetic test for determining the molecular diagnosis of this condition . The diagnostic workflow typically involves:

  • Clinical suspicion based on characteristic features (seizures, developmental delay, microcephaly)

  • Biochemical screening for abnormal glycosylation patterns

  • Molecular genetic testing, with trio WES proving particularly effective

  • Confirmation of identified variants through Sanger sequencing

  • Functional validation of novel variants through in vitro studies

The importance of WES in diagnosis is underscored by its ability to identify novel variants, as demonstrated in recent case reports . For laboratories performing genetic testing for ALG11 and other CDG-related genes, high-quality clinical-grade NGS assays provide excellent analytical performance, with sensitivity for single nucleotide variants approaching 99.89% and similarly high sensitivity for various types of insertions and deletions .

What potential therapeutic approaches are being explored for ALG11-CDG?

While the search results do not specifically detail therapeutic approaches for ALG11-CDG, general strategies being explored for congenital disorders of glycosylation may be applicable. These could include:

  • Substrate supplementation therapies aimed at boosting mannose availability

  • Enzyme replacement or enhancement strategies

  • Gene therapy approaches to deliver functional copies of ALG11

  • Pharmacological chaperones to improve stability of mutant ALG11 proteins

  • Symptomatic management of clinical manifestations (anti-seizure medications, developmental support)

The identification of decreased protein stability as a consequence of certain ALG11 variants suggests that approaches targeting protein stabilization might be particularly relevant. Further understanding of the specific molecular mechanisms underlying ALG11 dysfunction in different variants will be crucial for developing targeted therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.