Recombinant Human Ghrelin O-acyltransferase (MBOAT4)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Substrate Specificity

MBOAT4 catalyzes the octanoylation of ghrelin at Ser-3 using acyl-CoA donors (e.g., octanoyl-CoA). Key findings:

  • Substrate Recognition:

    • Requires the N-terminal motif GSSF in ghrelin .

    • Tolerates Thr substitution at Ser-3 but with reduced activity .

    • Binds acyl-CoA donors with chain lengths C8–C14 .

  • Kinetics:

    • Follows Michaelis-Menten kinetics .

    • Substrate availability (acyl-CoA/ghrelin) limits reaction rates .

  • pH Sensitivity:

    • Active across pH 6–9, with no significant activity loss .

Research Tools and Assays

Recombinant MBOAT4 is widely studied using specialized kits and inhibitors:

Detection Kits

Kit FeatureHuman MBOAT4 ELISA Kit (HUEB2417)MBOAT4 ELISA Kit (OKEH01715)
Detection Range0.312–20 ng/mL0.312–20 ng/mL
Sensitivity0.1 ng/mL0.1 ng/mL
Sample TypesSerum, plasma, tissue homogenatesSerum, plasma, cell culture supernatants
Intra-Assay CV5.9%5.9%
ApplicationsObesity, diabetes, metabolic disease studiesGhrelin pathway analysis
Data from

Inhibitors

  • Peptidomimetics: Compound 11 (IC₅₀ = 50 nM) blocks cellular ghrelin secretion 4× more effectively than earlier analogs .

  • GO-CoA-Tat: A bi-substrate inhibitor linking ghrelin’s N-terminus to coenzyme A (IC₅₀ = 3 μM) .

  • Fluorescent Probes: Ligand 15 binds His338, confirming its role in catalysis .

Metabolic Regulation

  • Fasting Response: MBOAT4 expression increases during fasting to maintain glucose levels .

  • Insulin Modulation: Inhibits insulin secretion, exacerbating hyperglycemia in obesity .

Disease Targets

ConditionRole of MBOAT4Therapeutic Approach
ObesityEnhances appetite via acylated ghrelinSmall-molecule inhibitors (e.g., 11)
Type 2 DiabetesReduces insulin sensitivitysiRNA silencing
Prostate CancerOverexpressed in tumor cellsFluorescent ligand targeting

Challenges and Future Directions

  • Structural Studies: Resolving MBOAT4’s 3D structure remains a priority for drug design .

  • Tissue-Specific Targeting: Developing inhibitors that spare non-GOAT MBOATs (e.g., ACAT1) .

  • Clinical Trials: No inhibitors have reached Phase III trials as of 2025 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MBOAT4; GOAT; OACT4; FKSG89; Ghrelin O-acyltransferase; Membrane-bound O-acyltransferase domain-containing protein 4; O-acyltransferase domain-containing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MBOAT4
Target Protein Sequence
MEWLWLFFLHPISFYQGAAFPFALLFNYLCIMDSFSTRARYLFLLTGGGALAVAAMGSYA VLVFTPAVCAVALLCSLAPQQVHRWTFCFQMSWQTLCHLGLHYTEYYLHEPPSVRFCITL SSLMLLTQRVTSLSLDICEGKVKAASGGFRSRSSLSEHVCKALPYFSYLLFFPALLGGSL CSFQRFQARVQGSSALHPRHSFWALSWRGLQILGLECLNVAVSRVVDAGAGLTDCQQFEC IYVVWTTAGLFKLTYYSHWILDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRIS VFSRKWNQSTARWLRRLVFQHSRAWPLLQTFAFSAWWHGLHPGQVFGFVCWAVMVEADYL IHSFANEFIRSWPMRLFYRTLTWAHTQLIIAYIMLAVEVRSLSSLWLLCNSYNSVFPMVY CILLLLLAKRKHKCN
Uniprot No.

Target Background

Function
Recombinant Human Ghrelin O-acyltransferase (MBOAT4) mediates the octanoylation of ghrelin at Serine 3. It utilizes a range of fatty acids as substrates, including octanoic acid, decanoic acid, and tetradecanoic acid.
Gene References Into Functions
  1. Plasma GOAT levels show high specificity and sensitivity in predicting prostate cancer presence, particularly in non-diabetic individuals. PMID: 27693462
  2. The role of the cysteine residue in ghrelin O-acyltransferase in ghrelin acylation. PMID: 28134508
  3. GOAT exhibits a preference for n-hexanoyl-CoA over n-octanoyl-CoA as an acyl donor, despite n-octanoyl ghrelin being the predominant form in the stomach. PMID: 27489223
  4. Characterization of the GOAT active site through the definition of substrate-enzyme interactions involved in ghrelin binding and recognition. PMID: 25562443
  5. GOAT is present in human plasma, with protein levels influenced by the metabolic environment; decreased levels are observed in anorexia nervosa, and increased levels in morbid obesity. PMID: 23454172
  6. Dysregulation of ghrelin system components, including ghrelin, the ghrelin receptor (GHSR1a), and GOAT, may contribute to the development and progression of various pathologies. PMID: 24194510
  7. Architectural organization of the metabolic regulatory enzyme GOAT. PMID: 24045953
  8. GOAT mRNA and protein expression is observed in both normal and cancerous prostate tissues. PMID: 23879975
  9. Higher GOAT levels are found in visceral adipose tissue from obese patients with type 2 diabetes. PMID: 22869322
  10. Genetic variation in GOAT is associated with anorexia nervosa (Review). PMID: 21930173
  11. GOAT expression in various tissues suggests the importance of both endocrine and paracrine effects of locally synthesized and acylated ghrelin. PMID: 21646729
  12. Genetic variation in GOAT may be involved in the etiology of anorexia nervosa. PMID: 21035823
  13. Modulation of GOAT or ghrelin signaling may offer a clinically relevant approach for treating metabolic diseases such as type 2 diabetes. PMID: 21150588
  14. Observational study of gene-disease association (HuGE Navigator). PMID: 21035823
  15. The presence of prostate cells, GOAT, and n-octanoic acid in the culture medium is required for n-octanoyl ghrelin production. PMID: 19628676
  16. Identification and characterization of human GOAT, the ghrelin O-acyl transferase. PMID: 18443287
  17. GOAT expression was observed in human immortalized chondrocyte cell lines and in cultured primary human chondrocytes. PMID: 19479831
Database Links

HGNC: 32311

OMIM: 611940

KEGG: hsa:619373

STRING: 9606.ENSP00000314196

UniGene: Hs.627194

Protein Families
Membrane-bound acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in stomach with moderate levels in pancreas and relatively low levels in most other tissues.

Q&A

What is the structural topology of human MBOAT4 and how has it been characterized?

MBOAT4 is a polytopic membrane protein that participates in lipid signaling reactions. While the complete three-dimensional structure has not been fully elucidated through crystallography, biochemical mapping tools have revealed that the enzyme consists of eleven transmembrane helical domains and one reentrant loop. The C-terminus is located on the cytosolic side of the endoplasmic reticulum, while the N-terminus resides in the lumen of the membrane . This topology is consistent with other membrane-bound O-acyltransferases, sharing similarities with acetyl-coenzyme A acetyltransferase 1 and glycerol uptake protein 1 .

Research teams working on structural characterization should consider combining computational prediction methods with biochemical approaches such as cysteine accessibility and glycosylation mapping to refine current structural models.

What is the specific catalytic mechanism of MBOAT4?

MBOAT4 catalyzes the transfer of an n-octanoyl group from octanoyl-CoA to the serine-3 residue of ghrelin . Research has demonstrated that this catalytic activity depends critically on specific amino acid recognition, particularly glycine-1, serine-3, and phenylalanine-4 of the ghrelin peptide . Mutation studies have shown that replacing serine-3 with alanine nearly eliminates the transfer activity, while substitutions at glycine-1 or phenylalanine-4 significantly reduce it .

The enzyme appears to utilize a histidine residue as a general base in its catalytic mechanism, as evidenced by mutagenesis studies coupled with ligand uptake experiments . This histidine residue likely facilitates the nucleophilic attack of the serine hydroxyl group on the thioester bond of octanoyl-CoA.

How does substrate recognition occur in MBOAT4?

Experimental evidence indicates that MBOAT4 recognizes a specific sequence within the N-terminal region of ghrelin. Studies using recombinant proghrelin with various amino acid substitutions have revealed that:

  • Glycine at position 1 is critical, as its replacement with serine markedly reduces activity

  • Serine at position 3 is essential as the acylation site

  • Phenylalanine at position 4 is important for recognition

  • Leucine at position 5 has a minor role

  • Positions beyond residue 5 appear to have minimal impact on recognition

Notably, MBOAT4 can transfer an octanoyl group to a pentapeptide containing only the N-terminal five amino acids of proghrelin, demonstrating that the minimal recognition sequence is contained within this region .

What are the most effective systems for recombinant expression of functional MBOAT4?

Based on research protocols, insect cell expression systems have proven particularly effective for producing functional MBOAT4. The baculovirus expression system using insect cells has successfully generated membrane preparations containing active MBOAT4 capable of transferring octanoyl groups to ghrelin substrates in vitro .

This methodology involves:

  • Cloning the MBOAT4 gene into a baculovirus transfer vector

  • Generating recombinant baculoviruses

  • Infecting insect cells (typically Sf9 or High Five cells)

  • Harvesting cells and preparing membrane fractions

  • Verifying expression through immunoblotting techniques

Researchers should note that mammalian expression systems have also been employed, particularly for studies investigating cellular localization and trafficking of MBOAT4, though these systems may yield lower enzymatic activity compared to insect cell systems.

What are validated biochemical assays for measuring MBOAT4 activity in vitro?

Several robust biochemical assays have been developed for measuring MBOAT4 activity:

  • Radiochemical assay using [³H]octanoyl-CoA:

    • Incubate membrane preparations containing MBOAT4 with [³H]octanoyl-CoA and recombinant proghrelin

    • Terminate reactions with detergent-containing buffer

    • Isolate labeled products using immunoprecipitation or SDS-PAGE

    • Quantify radioactivity by scintillation counting

  • Fluorescence-based assays:

    • Utilize fluorescently-labeled ghrelin peptides

    • Monitor changes in fluorescence properties upon acylation

    • Suitable for high-throughput screening applications

  • Mass spectrometry-based assays:

    • Incubate MBOAT4 with substrates

    • Analyze reaction products by LC-MS/MS

    • Quantify the ratio of acylated versus non-acylated ghrelin

For optimal assay performance, researchers should consider:

  • Including appropriate negative controls (heat-inactivated enzyme, S3A mutant substrates)

  • Establishing reaction linearity with respect to time and protein concentration

  • Optimizing buffer conditions (pH, detergent concentration, divalent cations)

What are effective methods for studying MBOAT4 inhibition?

Research has demonstrated several effective approaches for studying MBOAT4 inhibition:

  • Competitive inhibition assays using modified ghrelin peptides:

    • Studies have shown that octanoylated ghrelin pentapeptides can inhibit MBOAT4 activity

    • Replacing serine-3 with octanoylated diaminopropionic acid enhances inhibitory potency 45-fold compared to octanoylated serine

    • This suggests that amide-linked inhibitors are more effective than ester-linked ones

  • Structure-activity relationship studies:

    • Systematic modification of the acyl chain length and composition

    • Alterations to the peptide backbone and side chains

    • Incorporation of non-natural amino acids

  • High-throughput screening approaches:

    • Development of cell-based reporter assays

    • Fluorescence polarization assays using labeled peptide substrates

    • Enzyme-coupled spectrophotometric assays

What is the role of MBOAT4 in extracellular peptide interactions and ligand internalization?

Recent research has revealed an unexpected function of MBOAT4 beyond its catalytic role. Studies using fluorescent ghrelin-derived peptides have demonstrated that:

  • MBOAT4 can interact with extracellular ghrelin peptides

  • This interaction facilitates the internalization of ghrelin into cells

  • This process occurs in both transfected cell models and prostate cancer cells that endogenously express MBOAT4

These findings suggest a dual role for MBOAT4:

  • As an acyltransferase that activates ghrelin

  • As a cellular uptake mechanism that may participate in autocrine/paracrine signaling

This discovery has significant implications for understanding local ghrelin signaling pathways and potentially for developing targeted therapeutic approaches. Future research should investigate whether this internalization mechanism is specific to ghrelin or extends to other peptide hormones.

How do genetic variations in MBOAT4 correlate with metabolic phenotypes?

Recent genomic analyses have identified several single nucleotide polymorphisms (SNPs) in the MBOAT4 gene that may be associated with metabolic phenotypes:

SNP IDAmino Acid ChangeMAFPredicted PathogenicityAssociated Phenotype
rs561065025G57S<0.01High (most pathogenic)Potential obesity risk
HGMD variantA46TN/AConfirmed pathogenicAssociated with obesity

Research has employed several computational approaches to predict the functional impact of these variants:

  • MAF (minor allele frequency) cut-off criteria (<0.01)

  • Multiple bioinformatics prediction algorithms

  • Protein stability calculations (ΔΔG values)

  • Structural modeling and stereochemical quality assessment

These rare coding pathogenic mutations are predicted to decrease protein stability, potentially altering MBOAT4 function and contributing to metabolic disorders. Researchers should consider population-based studies to validate these associations and functional studies to confirm their impact on enzyme activity.

What is known about the molecular interactions between MBOAT4 and potential inhibitors?

Molecular docking studies have identified potential binding interactions between MBOAT4 and inhibitory compounds:

  • Blind cavity docking approaches have been used to identify druggable cavities within the MBOAT4 structure

  • Significant interactions have been observed with certain flavonoids, particularly Phloretin 3',5'-Di-C-Glucoside

  • Key residues involved in these interactions include R304, W306, N307, A311, L314, and H338

  • These interactions show favorable energetic parameters (iGEMDOCK: −95.82 kcal/mol; AutoDock: −7.80 kcal/mol)

Molecular dynamics simulation analyses have further validated these interactions, suggesting that these flavonoids could serve as starting points for developing MBOAT4 inhibitors. The identification of these binding sites provides valuable structural information for rational drug design approaches targeting MBOAT4.

What is the metabolic impact of MBOAT4 inhibition in experimental models?

Studies investigating the metabolic effects of MBOAT4 inhibition have yielded complex and sometimes contradictory results:

  • GOAT ablation in mouse models:

    • One study found that GOAT ablation in leptin-deficient ob/ob mice did not improve glucose homeostasis or reduce body adiposity

    • This suggests that neither acyl ghrelin nor an increased ratio of desacyl/acyl ghrelin is crucial for controlling glucose homeostasis in this specific model of obesity

  • Mechanistic considerations:

    • The effects of MBOAT4 inhibition may depend on the specific metabolic context (e.g., diet-induced obesity versus genetic obesity)

    • The relative importance of acyl versus desacyl ghrelin signaling may vary across different tissues and physiological states

    • Compensatory mechanisms may develop in chronic inhibition models

These findings highlight the complexity of ghrelin signaling and suggest that the metabolic effects of MBOAT4 inhibition may be context-dependent. Future research should investigate the effects in different models of metabolic disease and consider the temporal aspects of inhibition.

What is the potential of MBOAT4 as a therapeutic target for metabolic disorders?

Multiple lines of evidence suggest that MBOAT4 represents a promising therapeutic target:

  • Rationale for targeting MBOAT4:

    • MBOAT4 is essential for the activation of ghrelin, which stimulates appetite and regulates energy homeostasis

    • Inhibition could potentially reduce food intake and improve metabolic parameters

    • As a membrane-bound enzyme with a specific function, it may offer better selectivity than targeting ghrelin receptors

  • Challenges and considerations:

    • The complex interplay between acyl and desacyl ghrelin must be considered

    • Tissue-specific effects may complicate therapeutic outcomes

    • Potential compensatory mechanisms might develop with chronic inhibition

    • The role of MBOAT4 in processes beyond ghrelin acylation (e.g., peptide internalization) could lead to unintended effects

  • Promising approaches:

    • Development of small molecule inhibitors based on structural insights

    • Peptidomimetic approaches leveraging the substrate recognition requirements

    • Exploration of natural products such as flavonoids from Rutaceae family plants

What emerging technologies might advance MBOAT4 research?

Several cutting-edge technologies hold promise for advancing our understanding of MBOAT4:

  • Cryo-electron microscopy:

    • May help resolve the complete three-dimensional structure of MBOAT4

    • Could provide crucial insights into the catalytic mechanism and substrate binding

  • CRISPR/Cas9 genome editing:

    • Generation of tissue-specific knockout models

    • Introduction of specific SNPs to study their functional consequences

    • Creation of reporter systems for high-throughput screening

  • Single-cell analysis techniques:

    • Investigation of MBOAT4 expression and function across heterogeneous cell populations

    • Analysis of cell-specific responses to MBOAT4 inhibition

  • Advanced computational methods:

    • Molecular dynamics simulations with longer timescales

    • AI-driven approaches for inhibitor design

    • Systems biology modeling of ghrelin signaling networks

What are the critical unresolved questions in MBOAT4 biology?

Despite significant advances, several fundamental questions remain unanswered:

  • Detailed catalytic mechanism:

    • Precise identification of all catalytic residues

    • Understanding the conformational changes during catalysis

    • Elucidation of the complete reaction mechanism

  • Regulatory mechanisms:

    • How is MBOAT4 expression and activity regulated under different physiological conditions?

    • What post-translational modifications affect MBOAT4 function?

    • Are there endogenous inhibitors or activators?

  • Biological functions beyond ghrelin acylation:

    • Comprehensive characterization of MBOAT4's role in peptide internalization

    • Identification of other potential substrates beyond ghrelin

    • Investigation of potential non-catalytic functions

  • Tissue-specific roles:

    • Function in different tissues where it is expressed (brain, pancreas, etc.)

    • Cell type-specific effects in heterogeneous tissues

    • Role in developmental processes and aging

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.