Recombinant Human Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein (GTSCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, we prioritize developing specified tags if requested. Please indicate your preferred tag type at the time of ordering.
Synonyms
GTSCR1; Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GTSCR1
Target Protein Sequence
MQSDIYHPGHSFPSWVLCKVTYTILATASQVGSFARKTHQNGDLQIRGGRGRRESTEIFQ VASVTEGEESPPAICMEVFLFLWFIAPIYACVCRIFKIQVRNTVKNSSTASLAPSISTSE ERQIRIERHHYHLYGQ
Uniprot No.

Target Background

Database Links

HGNC: 18406

KEGG: hsa:220158

UniGene: Hs.448217

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is GTSCR1 and what is its relevance to Tourette Syndrome research?

GTSCR1 (Gilles de la Tourette Syndrome Chromosomal Region Candidate Gene 1) is a protein that has been identified as a potential candidate gene in the pathobiology of Tourette Syndrome (TS). The protein consists of 136 amino acids in its full-length form and is being investigated as part of broader efforts to understand the genetic basis of TS . While the exact function of GTSCR1 remains to be fully elucidated, it is among several genes of interest in TS research, alongside other candidate genes such as SLITRK1, HDC, BTBD9, and SLC6A4 that have attracted considerable attention in recent studies . Tourette Syndrome's genetic basis continues to be unclear, which has motivated targeted sequencing approaches to identify potentially causal variants across multiple candidate genes that may contribute to the condition's complex etiology.

How should researchers approach experimental design when studying GTSCR1?

For GTSCR1 specifically, consider:

  • Power calculations to determine appropriate sample sizes, while acknowledging the limitations due to variability in assays and study populations

  • Inclusion of appropriate controls (both positive and negative)

  • Accounting for potential confounding variables and comorbidities common in TS, such as obsessive-compulsive disorder (OCD) and attention-deficit hyperactivity disorder (ADHD)

  • Implementing validation methods to confirm findings, such as Sanger sequencing for genetic variants

What are the specifications of commercially available recombinant GTSCR1 protein?

Recombinant Full Length Human Gilles de la Tourette Syndrome Chromosomal Region Candidate Gene 1 Protein (GTSCR1) is available for research purposes with the following specifications:

Catalog #Source (Host)SpeciesTagProtein Length
RFL215HFE. coliHumanHisFull Length (1-136)

This recombinant protein is produced in E. coli expression systems and includes a histidine tag to facilitate purification and detection in experimental applications . When selecting a recombinant GTSCR1 protein for your research, consider whether the expression system, tag type, and protein length are suitable for your specific experimental requirements.

How can next-generation sequencing approaches be optimized for GTSCR1 analysis?

Optimizing next-generation sequencing (NGS) for GTSCR1 analysis requires careful consideration of several methodological aspects:

  • Target selection: For targeted re-sequencing approaches, design primers using tools like PRIMER3 and validate uniqueness using in-silico PCR. Target amplicons should be 300-400 bp for optimal sequencing performance .

  • Quality control metrics: Ensure >95% of bases are sequenced with >99.9% accuracy, with coverage exceeding 100X for reliable variant detection .

  • Variant identification and prioritization: Employ algorithms such as VAAST to identify potentially disease-causing variants under different modes of inheritance. Prioritize variants using tools like Variant Ranker, focusing on functionally important non-synonymous exonic variants .

  • Validation protocol: Confirm identified variants through orthogonal methods such as Sanger sequencing on an ABI sequencer using BigDye Terminator chemistry .

  • Bioinformatic pipeline: Implement a comprehensive analysis pipeline that includes variant calling, functional prediction (using algorithms like MutationTaster), and linkage disequilibrium analysis to identify associations with other known variants .

This approach has successfully identified rare variants in TS candidate genes, demonstrating its utility for GTSCR1 investigations.

What statistical approaches are recommended for analyzing GTSCR1 genetic variation data?

When analyzing GTSCR1 genetic variation data, researchers should consider these statistical approaches:

  • Latent Class Analysis (LCA): This approach has proven valuable in identifying subphenotypes of Tourette Syndrome. LCA can help classify patients based on combinations of TS with comorbid conditions like OCD and ADHD, potentially revealing distinct genetic associations .

  • Heritability assessment: Variance components approaches can be used to assess heritability of categorical diagnoses and latent classes, helping to establish the genetic contribution to phenotypes that may involve GTSCR1 .

  • Linkage Disequilibrium (LD) analysis: Tools such as LDproxy and LdOOKUP can identify proxy LD SNPs and browse for variants in LD with findings from other GWAS studies, brain eQTL data, and the NHGRI GWAS catalog .

  • Cross-platform normalization: For transcriptomic data involving GTSCR1, novel techniques like MACAROON (MicroArray Cross-plAtfoRm pOst-prOcessiNg) can correct processed microarray data from multiple experiments, addressing heterogeneity issues in high-throughput data .

These statistical methods should be applied with consideration of the heterogeneity inherent in TS phenotypes and the complexities of genetic variation data.

How can researchers integrate GTSCR1 findings with broader genomic and clinical data?

Integration of GTSCR1 research findings with broader datasets requires a multifaceted approach:

  • Text-mining standardization: Apply text-mining processes to standardize clinical labels in high-throughput repositories, identifying exclusively patient data and excluding non-human data and immortalized cell lines .

  • Machine learning models: Develop models that highlight transformations applied to original data submissions, facilitating cross-platform integration .

  • Clinical correlation: Link genetic findings to clinical outcomes through approaches similar to those used in cancer biomarker studies, where patients treated according to their biomarker levels achieved significantly better clinical outcomes .

  • Subtyping approaches: Use methods that allow subtyping of patients based on integrated data (e.g., linking real-world data with RNA-Seq data) and prediction of clinical outcomes accordingly .

  • Proxy variant analysis: When direct association is unclear, investigate variants in linkage disequilibrium with GTSCR1 variants. For example, in SLITRK1 studies, variants in LD with identified rare variants were found to be associated with response to citalopram treatment, providing insights into potential biological mechanisms .

This integrated approach can provide a more comprehensive understanding of GTSCR1's role in Tourette Syndrome pathophysiology.

What approaches can effectively distinguish GTSCR1-related phenotypes in heterogeneous TS populations?

Distinguishing GTSCR1-related phenotypes within heterogeneous TS populations requires sophisticated phenotyping approaches:

  • Latent Class Analysis (LCA): LCA has demonstrated effectiveness in identifying distinct subphenotypes of TS. In a study of 952 individuals from 222 TS families, LCA identified a best-fit five-class solution based on combinations of TS, obsessive-compulsive disorder (OCD), OC symptoms/behaviors, and attention-deficit hyperactivity disorder (ADHD) .

  • Standardized assessment battery: Implement comprehensive clinical assessments using structured interviews such as the Kiddie-Schedule for Affective Disorders and Schizophrenia (K-SADS) for children and the Structured Clinical Interview for DSM-IV Axis I Disorders (SCID) for adults .

  • Severity quantification: Use validated scales like the Yale Global Tic Severity Scale (YGTSS) to assess present and worst-ever lifetime tic severity, providing quantitative measures for correlation with genetic findings .

  • Replication validation: Perform analyses on independent samples to validate class solutions. For example, in the cited study, two random sibling samples produced virtually identical LCA results, confirming the robustness of the identified phenotypic classes .

  • Comorbidity pattern analysis: Pay particular attention to patterns of comorbidity, as these provide important distinguishing features between subclasses. The identified classes included: GTS+OCS/OCB; GTS+OCD; and GTS+OCD+ADHD-Combined, each potentially representing distinct genetic etiologies .

These methodological approaches can help researchers identify more homogeneous subgroups within TS populations, potentially facilitating the discovery of specific GTSCR1 associations.

What validation techniques are recommended for confirming GTSCR1 variants identified through sequencing?

Proper validation of GTSCR1 variants requires a systematic approach:

  • Sanger sequencing validation: After identifying variants through next-generation sequencing, confirm them via Sanger sequencing. Design PCR primers using PRIMER3 and confirm uniqueness using UCSC in-silico PCR tools .

  • Functional prediction algorithms: Apply multiple prediction tools such as MutationTaster to assess the potential functional impact of identified variants. Prioritize those predicted to be deleterious for further investigation .

  • Population frequency assessment: Compare variant frequencies with population databases to identify rare variants (e.g., MAF < 0.5%) that may have functional significance .

  • Inheritance pattern analysis: Use algorithms like VAAST to identify potentially disease-causing variants under different modes of inheritance (dominant, recessive) .

  • Linkage disequilibrium investigation: For validated variants, use tools like LDproxy to identify proxy LD SNPs and explore potential associations with other GWAS findings, which may provide insight into functional relevance .

This comprehensive validation approach ensures that identified GTSCR1 variants represent genuine findings rather than technical artifacts, providing a solid foundation for further functional studies.

How should researchers design experiments to investigate GTSCR1's potential role in Tourette Syndrome pathophysiology?

When designing experiments to investigate GTSCR1's role in TS pathophysiology, consider these methodological approaches:

  • Cross-disciplinary integration: Design experiments that integrate genomic, transcriptomic, proteomic, and metabolomic approaches, as these technologies survey different aspects of cellular responses but require universal approaches to experimental design and high-level data analysis .

  • Dynamic state considerations: Unlike static genomic sequencing, transcriptomes, proteomes, and metabolomes are dynamic. Experimental designs must link analyses to the specific state of biological samples under investigation .

  • Genetic variation impact: Account for how genetic variation influences an organism's response to stimuli, as this may modulate GTSCR1's functional effects .

  • Biologic inference foundation: Ensure the experimental design reflects the specific question being asked, the limitations of the experimental system, and the methods that will be used to analyze the data .

  • Family-based approaches: Consider utilizing family trios in your study design, as this approach has been successful in previous TS genetic studies and allows for more powerful detection of inheritance patterns .

These design considerations will help researchers develop robust experimental frameworks for investigating GTSCR1's potential contributions to TS pathophysiology.

How can researchers interpret the functional significance of rare GTSCR1 variants?

Interpreting the functional significance of rare GTSCR1 variants requires a multifaceted approach:

  • Prioritization algorithms: Use specialized ranking algorithms (like Variant Ranker) to prioritize variants based on predicted functional impact. Focus on non-synonymous exonic variants that may alter protein function .

  • Functional prediction tools: Apply multiple computational tools (such as MutationTaster) to predict the deleterious nature of identified variants. Variants consistently predicted to be deleterious across multiple algorithms warrant prioritization for functional studies .

  • Linkage disequilibrium analysis: Investigate whether identified variants are in LD with variants implicated in other studies or conditions. For example, a variant in SLITRK1 (a TS candidate gene) was found to be in LD with a variant associated with response to citalopram treatment, providing potential functional insights .

  • Frequency assessment: Evaluate the rarity of variants in population databases. Extremely rare variants (e.g., MAF = 0.13%) that are predicted to be deleterious may have stronger functional significance .

  • Conservation analysis: Consider evolutionary conservation at variant positions as an indicator of functional importance. Highly conserved regions are likely to have critical functional roles.

By systematically applying these analytical approaches, researchers can prioritize GTSCR1 variants for further functional characterization and assess their potential contribution to TS pathophysiology.

What strategies can help researchers overcome challenges in cross-platform data integration for GTSCR1 studies?

Cross-platform data integration for GTSCR1 studies presents several challenges that can be addressed through these strategies:

  • Standardized preprocessing: Apply consistent preprocessing methodologies to minimize technical variation while preserving biological signals. Novel techniques like MACAROON use language processing to build machine learning models that highlight transformations applied at the original data submission .

  • Batch effect correction: Implement robust batch effect correction methods to account for systematic differences between datasets generated on different platforms or at different times.

  • Reference standardization: Use common reference standards across experiments to facilitate data normalization and integration.

  • Metadata harmonization: Apply text-mining processes to standardize clinical labels in high-throughput repositories, ensuring consistent annotation across datasets .

  • Validation through orthogonal methods: Confirm key findings using independent methodologies. For example, validate next-generation sequencing results with Sanger sequencing .

These strategies can help researchers integrate data from diverse sources, providing a more comprehensive understanding of GTSCR1's role in Tourette Syndrome and related conditions.

How might emerging technologies enhance our understanding of GTSCR1's role in Tourette Syndrome?

Emerging technologies offer promising avenues for advancing GTSCR1 research:

  • Single-cell sequencing: This technology can reveal cell type-specific expression patterns of GTSCR1, potentially identifying critical neural populations involved in TS pathophysiology.

  • CRISPR-based functional genomics: Genome editing tools can enable precise manipulation of GTSCR1 and its regulatory elements, facilitating functional characterization in cellular and animal models.

  • Spatial transcriptomics: These methods can map GTSCR1 expression within specific brain regions and circuits, providing insights into its anatomical relevance to TS.

  • Long-read sequencing: Technologies like PacBio and Oxford Nanopore can better characterize complex structural variants and repetitive regions that may be missed by short-read sequencing approaches .

  • Multi-omics integration: Comprehensive integration of genomic, transcriptomic, proteomic, and metabolomic data can provide a systems-level understanding of how GTSCR1 variants influence cellular and physiological processes relevant to TS .

The application of these technologies to GTSCR1 research may reveal new insights into its function and potential therapeutic targeting in Tourette Syndrome.

What are the most promising approaches for translating GTSCR1 research findings into clinical applications?

Translating GTSCR1 research into clinical applications may follow these promising approaches:

  • Biomarker development: Investigate whether GTSCR1 variants or expression patterns can serve as biomarkers for TS diagnosis, subtype classification, or treatment response prediction. Previous studies have shown that patients treated according to their biomarker levels achieved significantly better clinical outcomes .

  • Phenotype-based patient stratification: Apply latent class analysis approaches to stratify patients based on comorbidity patterns and clinical features, potentially identifying GTSCR1-associated subgroups with distinct treatment responses .

  • Pharmacogenomic applications: Explore associations between GTSCR1 variants and treatment responses, similar to how variants in LD with SLITRK1 variants were associated with citalopram treatment response .

  • Target validation: Use functional genomics approaches to validate GTSCR1 as a potential therapeutic target, assessing whether modulation of its expression or function affects TS-relevant phenotypes in model systems.

  • Precision medicine implementation: Develop clinical algorithms that incorporate GTSCR1 genetic information alongside other biomarkers and clinical data to guide personalized treatment decisions for TS patients.

These translational approaches could bridge the gap between basic GTSCR1 research and clinical applications, ultimately improving outcomes for patients with Tourette Syndrome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.