Recombinant Human Glioma pathogenesis-related protein 1 (GLIPR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you require a specific tag, please inform us for preferential development.
Synonyms
CRISP 7; CRISP7; GLI pathogenesis related 1; GLI pathogenesis-related 1 (glioma); Glioma pathogenesis related protein 1; Glioma pathogenesis-related protein 1; GLIP1_HUMAN; GliPR 1; GLIPR; GLIPR1; Protein RTVP-1; RELATED TO TESTIS SPECIFIC; VESPID; AND PATHOGENESIS PROTEINS 1; RTVP 1; RTVP1; Testes specific vespid and pathogenesis protein 1; testes-specific vespid and pathogenesis protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-266
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
GLIPR1
Target Protein Sequence
ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNT RLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQV VWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKC LDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPN LVLLD
Uniprot No.

Target Background

Gene References Into Functions
  1. GLIPR1 expression is low in human bladder cancer tissues and inhibits TPX2 expression. (PMID: 28799673)
  2. High GLIPR1 expression correlates with cisplatin resistance in lung cancer. (PMID: 28771580)
  3. GLIPR1 and miR-16 regulate proliferation, migration, invasion, and cancer-initiating cells in osteosarcoma. (PMID: 27460987)
  4. PRMT5/WDR77 regulates GLIPR1 expression to control lung cancer cell growth. (PMID: 26988096)
  5. RTVP-1 overexpression in human neural stem cells induces mesenchymal differentiation; silencing in glioma stem cells reduces mesenchymal transformation and stemness. (PMID: 26267319)
  6. RTVP-1 regulates glioma cell spreading, migration, and invasion via N-WASP interaction and by modulating hnRNPK's inhibitory effect on N-WASP. (PMID: 26305187)
  7. Adenoviral GLIPR1 gene therapy (AdGLIPR1) combined with radiotherapy may synergistically control prostate and bladder tumors. (PMID: 23433894)
  8. GLIPR1 overexpression in AML samples suggests its potential as a therapeutic target. (PMID: 24008279)
  9. miR-137 inhibits glioblastoma stem cell self-renewal and promotes differentiation by targeting RTVP-1, which downregulates CXCR4. (PMID: 23714687)
  10. GLIPR1 interacts with Hsc70; GLIPR1 overexpression or Hsc70 knockdown suppresses AURKA and TPX2 transcription. (PMID: 23333597)
  11. GLIPR1's central cavity likely mediates CAP protein binding to shared ligands. (PMID: 21931216)
  12. GLIPR1 and c-Myc expression are inversely correlated in prostate cancer. (PMID: 22025562)
  13. RTVP-1 influences serum response factor's effect on glioma cell migration. (PMID: 21777672)
  14. GLIPR1 is a methylation-silenced gene in acute myeloid leukemia. (PMID: 21922325)
  15. GLIPR1 expression is downregulated or lost due to promoter methylation in acute myeloid leukemia. (PMID: 19483285)
  16. X-ray data (resolution >1.9 Å) of GLIPR1 crystal suggests a monomer or dimer structure. (PMID: 21045302)
  17. HIV-1 induces GliPR expression in P4-CCR5 cells. (PMID: 20356381)
  18. RTVP-1 gene expression is downregulated in human prostate cancer compared to normal tissue at the mRNA and protein levels. (PMID: 14871827)
  19. RTVP-1 and GLIPR1L genes are part of a novel p53 target gene cluster. (PMID: 16714093)
  20. RTVP-1b is a novel splice variant isolated from the U87 glioma cell line. (PMID: 17825796)
  21. GLIPR1/RTVP-1 deregulation plays a role in early Wilms tumorigenesis. (PMID: 18030365)
  22. GLIPR1 is a proapoptotic tumor suppressor acting via the ROS-JNK pathway. (PMID: 18199537)
Database Links

HGNC: 17001

OMIM: 602692

KEGG: hsa:11010

STRING: 9606.ENSP00000266659

UniGene: Hs.205558

Protein Families
CRISP family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
According to PubMed:8973356, it is ubiquitously expressed with high levels in lung and kidney and low levels in heart and liver. Highly expressed in cell lines derived from nervous system tumors arising from glia, low or absent in non-glial-derived nervou

Q&A

What is the basic structure and localization of GLIPR1?

GLIPR1 is a 266 amino acid (~30 kDa) member of the CAP superfamily (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins). The protein contains an N-terminal signal peptide that directs its secretion, a conserved cysteine-rich CAP domain, and a C-terminal transmembrane domain (TMD) . This structure suggests that GLIPR1 is translocated to the endoplasmic reticulum and trafficked to the cell surface as an integral membrane protein .

Cellular localization studies have confirmed that GLIPR1 is primarily found in the endoplasmic reticulum and in cytoplasmic vesicles . The presence of a signal peptide sequence enables GLIPR1 to enter the secretory pathway. Additionally, structural studies of a truncated soluble domain of GLIPR1 have revealed extensive flexible loop/turn regions and unique charge distributions not observed in previously reported CAP protein structures .

How does GLIPR1 expression vary across different cancer types?

GLIPR1 demonstrates remarkable variability in expression patterns across different cancer types, suggesting context-dependent roles:

Cancer TypeGLIPR1 ExpressionFunctionReference
Prostate CancerDownregulatedTumor suppressor
Glioblastoma/GliomaUpregulatedOncogene/Promotes proliferation
Wilms' TumorUpregulatedPotential oncogene
MelanomaVariable (higher in invasive forms)Promotes migration and invasion
AML (particularly FAB types M4, M4E, M5)UpregulatedAssociated with myelomonocytic differentiation

In prostate cancer, GLIPR1 is downregulated through hypermethylation of its promoter region, while in Wilms' tumor, hypomethylation is observed . Melanoma cells with higher endogenous GLIPR1 levels display significantly greater migration and invasion capability compared to cells with lower GLIPR1 expression .

What are the primary cellular pathways affected by GLIPR1?

Microarray analyses following GLIPR1 knockdown have identified several overrepresented Gene Ontology (GO) categories affected by GLIPR1 expression:

  • G protein signaling pathways (7 downregulated genes)

  • Regulation of cyclin-dependent protein kinase activity (4 downregulated genes)

  • ER to Golgi vesicle-mediated transport (3 downregulated genes)

  • Axon guidance (10 downregulated genes)

  • Dephosphorylation (1 upregulated gene; 6 downregulated genes)

Notable genes significantly downregulated following GLIPR1 suppression include APC, EGFR, DNAJC6, GNB5, APBB2, and phosphodiesterase 1A (PDE1A) . These findings suggest that GLIPR1 plays important roles in regulating G protein signaling and cell cycle progression, which may contribute to its context-dependent effects in different cancer types.

How does GLIPR1 mechanistically promote invasion in glioma and melanoma cells?

GLIPR1 expression positively correlates with in vitro cell migration and invasion in melanoma and glioma cell lines (r² = 0.94 and r² = 0.91 respectively) . Cell lines with the highest GLIPR1 expression (NZM9, NZM40, U251, SNB75) showed the highest number of migrating and invading cells, while those with relatively low levels of GLIPR1 (NZM12, NZM15, NZM45) demonstrated little to no migration and no detectable invasion .

siRNA-mediated knockdown of GLIPR1 resulted in significant decreases in both migration and invasion:

Cell LineMigration Decrease After GLIPR1 KnockdownInvasion Decrease After GLIPR1 Knockdown
SNB75 (glioma)~50%24%
NZM40 (melanoma)20-30%30%
NZM9 (melanoma)20-30%~38%
U251 (glioma)20-30%8%

Mechanistically, the data suggests that a threshold level of GLIPR1 expression may be necessary for a strongly invasive phenotype, as GLIPR1 levels in cells after siRNA-mediated knockdown were still higher than that in untreated and weakly invasive cell lines . GLIPR1 knockdown also caused a modest but reproducible decrease in proliferation (10-22% in melanoma cells; 25-31% in glioma cells), suggesting that GLIPR1 may play a role in cell growth that could contribute to its effects on invasion .

What are the structural and functional implications of GLIPR1's zinc-binding capability?

Structural studies of a truncated soluble domain of human GLIPR1 (sGLIPR1) have revealed that GLIPR1 can coordinate Zn²⁺ ions similarly to snake-venom cysteine-rich secretory proteins (CRISPs) . The crystal structure of the Zn²⁺ complex refined to 2.2 Å resolution demonstrated that the putative binding cavity coordinates Zn²⁺ in a manner similar to snake-venom CRISPs, which are involved in Zn²⁺-dependent mechanisms of inflammatory modulation .

This zinc-binding capability may have significant implications for GLIPR1's biological functions. In snake-venom CRISPs, zinc binding is associated with inflammatory modulation, suggesting that GLIPR1 may similarly participate in inflammation-related processes in human tissues . Furthermore, this metal-binding capacity could potentially be exploited for therapeutic targeting or inhibitor design.

How effective is GLIPR1-based gene therapy in clinical trials for prostate cancer?

GLIPR1 has been investigated as a therapeutic target in a phase I clinical trial for prostate cancer. The trial evaluated the safety and activity of neoadjuvant intraprostatic injection of a GLIPR1-expressing adenovirus for intermediate or high-risk localized prostate cancer before radical prostatectomy .

Eligible patients had localized prostate cancer (T1-T2c) with Gleason score ≥7 or prostate-specific antigen ≥10 ng/mL and received the adenoviral vector expressing the GLIPR1 gene by a single injection into the prostate, followed four weeks later by radical prostatectomy . Six viral particle (vp) dose levels were evaluated: 10¹⁰, 5×10¹⁰, 10¹¹, 5×10¹¹, 10¹², and 5×10¹² vp .

While the detailed results are not fully provided in the search results, it's noted that a randomized trial design with a control arm receiving intraprostatic adenovirus vector not carrying GLIPR1 might have been more optimal for proper evaluation of efficacy . This suggests that while preclinical data supports GLIPR1's tumor-suppressive role in prostate cancer, robust clinical evidence for its therapeutic efficacy requires further investigation with properly controlled trials.

What experimental approaches are most effective for studying GLIPR1 function in different cellular contexts?

Based on the literature, several experimental approaches have proven effective for studying GLIPR1 function:

  • siRNA-mediated knockdown: This approach has been successfully used to reduce GLIPR1 expression and assess resulting phenotypic changes. Studies have employed ON-TARGET plus SMARTpool siRNAs with a final concentration of 10 nM, with knockdown confirmation by RT-qPCR (24h) and western blotting (72h) post-transfection .

  • Protein localization studies: Immunofluorescence microscopy and subcellular fractionation have been used to determine that GLIPR1 localizes to the endoplasmic reticulum and cytoplasmic vesicles .

  • Transwell migration and invasion assays: These assays have been crucial for establishing GLIPR1's role in cell migration and invasion. Quantification involves counting the number of cells per field of view in multiple microscopic fields per well .

  • Gene expression profiling: Microarray analysis following GLIPR1 knockdown has revealed downstream regulatory targets and associated functional categories, providing insights into GLIPR1's role in various cellular processes .

  • Structural studies: X-ray crystallography of truncated GLIPR1 has provided insights into its three-dimensional structure and potential for metal ion coordination, with implications for its function .

What are the best methods for producing and purifying recombinant human GLIPR1?

While the search results don't specifically detail the production and purification of recombinant human GLIPR1, the structural studies mentioned in result imply successful production of a truncated soluble domain of the human GLIPR1 protein (sGLIPR1). Based on this and general practices for recombinant protein production, the following methodology would be appropriate:

  • Expression system selection: Due to GLIPR1's glycosylation and disulfide bonds (as part of the cysteine-rich CAP domain), a eukaryotic expression system such as mammalian cells (HEK293 or CHO) or insect cells (using baculovirus) would be preferable over bacterial systems.

  • Construct design: For full-length GLIPR1, include the signal peptide for proper processing. For structural or functional studies, consider a truncated version excluding the transmembrane domain (similar to the sGLIPR1 used in crystal structure determination).

  • Affinity tags: Incorporate a cleavable affinity tag (His6, FLAG, or GST) for purification purposes.

  • Purification strategy:

    • Initial capture using affinity chromatography based on the chosen tag

    • Intermediate purification using ion exchange chromatography

    • Polishing step using size exclusion chromatography

    • Consider detergent solubilization if working with the full-length protein containing the transmembrane domain

  • Quality control: Assess purity by SDS-PAGE, confirm identity by western blotting or mass spectrometry, and verify activity through functional assays such as those measuring effects on cell migration or invasion.

How can GLIPR1 expression be accurately quantified in tumor samples?

Based on the methods described in the search results, the following approaches are effective for quantifying GLIPR1 expression:

  • RT-qPCR: For transcript-level quantification, real-time quantitative PCR has been used to measure GLIPR1 mRNA levels . This method allows for sensitive detection of expression differences between samples.

  • Western blotting: For protein-level quantification, western blotting with densitometric analysis has been employed. The search results mention using a GS-700 Imaging Densitometer (BioRad) and quantifying band intensities using BioRad Quantity One software .

  • Microarray analysis: For broader transcriptomic profiling that includes GLIPR1, microarray analysis has been utilized to compare expression levels across different cancer types and cell lines .

  • Immunohistochemistry: While not explicitly mentioned in the search results, immunohistochemical staining would be appropriate for detecting GLIPR1 protein in tumor tissue sections, especially for assessing subcellular localization.

When analyzing GLIPR1 expression in clinical samples, it's important to consider that expression varies significantly between cancer types and subtypes. For example, in AML, GLIPR1 expression differs between FAB types, with M4, M4E, and M5 characterized by high expression values compared to other FAB groups . Similarly, AML patients with translocation t(15;17) or inversion inv(16) show increased expression compared to non-leukemia controls .

What experimental designs best demonstrate the dual role of GLIPR1 as both tumor suppressor and oncogene?

To effectively demonstrate GLIPR1's context-dependent roles as both tumor suppressor and oncogene, the following experimental designs would be most informative:

  • Comparative expression analysis across cancer types:

    • Analyze GLIPR1 expression (mRNA and protein) in matched tumor/normal tissue pairs from prostate cancer, glioblastoma, melanoma, and other relevant cancer types

    • Correlate expression with clinical parameters and outcomes

    • Include epigenetic analysis (methylation status of GLIPR1 promoter) to explain expression differences

  • Functional studies with bidirectional modulation:

    • In prostate cancer models (low GLIPR1): Perform overexpression studies using adenoviral vectors (as in the clinical trial) or stable transfection

    • In glioblastoma/melanoma models (high GLIPR1): Perform knockdown studies using siRNA (as described in result )

    • Measure common endpoints (proliferation, apoptosis, migration, invasion) in both models to demonstrate opposite effects

  • Molecular pathway analysis:

    • Conduct gene expression profiling (microarray or RNA-seq) after GLIPR1 modulation in different cancer types

    • Perform pathway enrichment analysis to identify cancer-type specific signaling networks

    • Use western blotting to validate key signaling nodes (e.g., G protein signaling components, cell cycle regulators)

  • In vivo models:

    • Xenograft models with GLIPR1-modulated cell lines (both overexpression in prostate cancer and knockdown in glioblastoma/melanoma)

    • Patient-derived xenografts treated with GLIPR1-targeting therapies

    • Genetic mouse models with tissue-specific GLIPR1 modulation

The adenoviral delivery approach mentioned in result demonstrated that increased GLIPR1 expression resulted in "increased apoptosis, accompanied by decreased tumor progression and metastasis" in an orthotopic model for metastatic prostate cancer . This contrasts with findings in glioma and melanoma where GLIPR1 promotes invasion and migration, highlighting its dual role.

How does GLIPR1 glycosylation affect its function in different cellular contexts?

While the search results mention that GLIPR1 is a glycosylated transmembrane protein , they don't elaborate on how glycosylation affects its function. This represents an important knowledge gap in GLIPR1 biology.

A comprehensive investigation of GLIPR1 glycosylation would include:

  • Identification of glycosylation sites: Use mass spectrometry to identify specific N-linked and O-linked glycosylation sites on GLIPR1.

  • Glycosylation site mutagenesis: Generate glycosylation site mutants (e.g., NXS/T to QXS/T for N-linked sites) and assess effects on:

    • Protein folding and stability

    • Subcellular localization

    • Cell surface expression

    • Interaction with binding partners

    • Functional activities (migration, invasion, proliferation)

  • Glycosylation inhibitors: Treat cells with tunicamycin (N-linked glycosylation inhibitor) or benzyl-α-GalNAc (O-linked glycosylation inhibitor) and assess effects on GLIPR1 function.

  • Cancer-specific glycosylation patterns: Compare GLIPR1 glycosylation patterns between cancer types where it exhibits opposite functions (prostate cancer vs. glioblastoma).

Understanding the role of glycosylation in GLIPR1 function could potentially explain its context-dependent activities and provide novel therapeutic targeting strategies.

What is the relationship between GLIPR1 and the tumor microenvironment?

The search results don't directly address GLIPR1's interaction with the tumor microenvironment, presenting another important research direction.

Key questions to investigate include:

  • GLIPR1 expression in stromal cells: Determine whether tumor-associated fibroblasts, immune cells, or endothelial cells express GLIPR1 and how this affects tumor progression.

  • Secreted vs. membrane-bound GLIPR1: As GLIPR1 has both a signal peptide and transmembrane domain, investigate whether a secreted form exists and what role it might play in cell-cell communication within the tumor microenvironment.

  • Immune modulation: Given GLIPR1's similarity to snake-venom CRISPs involved in inflammatory modulation and its zinc-binding capability , explore whether GLIPR1 affects immune cell recruitment, activation, or function.

  • Extracellular matrix interaction: Investigate whether GLIPR1 affects the production or degradation of extracellular matrix components, potentially explaining its role in invasion.

  • Hypoxia response: Determine whether hypoxic conditions in the tumor microenvironment affect GLIPR1 expression and function.

This research direction could reveal new insights into GLIPR1's role in cancer progression beyond its direct effects on tumor cells.

How do specific mutations or variants of GLIPR1 correlate with cancer susceptibility or progression?

The search results don't mention specific GLIPR1 mutations or variants associated with cancer. A comprehensive investigation would include:

  • Genomic analysis: Mine cancer genomics databases (TCGA, ICGC) for GLIPR1 mutations, copy number variations, and structural variations across cancer types.

  • Functional characterization: Generate common GLIPR1 variants through site-directed mutagenesis and assess effects on protein function.

  • Population studies: Conduct case-control studies to identify GLIPR1 SNPs associated with cancer risk or progression.

  • Prognostic significance: Correlate specific GLIPR1 variants with patient outcomes across different cancer types.

  • Therapeutic implications: Determine whether specific GLIPR1 variants predict response to targeted therapies or conventional treatments.

This research could potentially identify GLIPR1 as a biomarker for cancer susceptibility or as a predictive marker for treatment response.

How can the contradictory roles of GLIPR1 as both tumor suppressor and oncogene be reconciled?

The search results highlight the context-dependent roles of GLIPR1 as a tumor suppressor in prostate cancer and an oncogene in glioblastoma and melanoma . This apparent contradiction might be reconciled through several hypotheses:

Testing these hypotheses would require comprehensive molecular profiling of GLIPR1's interactome, signaling pathways, and post-translational modifications across different cancer types.

How reliable are the current methodologies for studying GLIPR1 function in cancer cells?

The search results describe several methodologies for studying GLIPR1, each with potential limitations:

To enhance reliability, future studies should:

  • Employ multiple approaches to modulate GLIPR1 (siRNA, CRISPR/Cas9, small molecule inhibitors)

  • Include appropriate controls and rescue experiments

  • Validate findings across multiple cell lines and in vivo models

  • Use complementary methodologies to assess each phenotype

  • Design clinical trials with appropriate control arms

What explains the differential GLIPR1 expression patterns in various AML subtypes?

The search results indicate that GLIPR1 expression varies significantly between different AML subtypes, with FAB types M4, M4E, and M5 characterized by high expression values compared to other FAB groups . Additionally, AML patients with translocation t(15;17) or inversion inv(16) showed increased expression compared to non-leukemia controls .

Several hypotheses could explain these differential expression patterns:

  • Lineage-specific regulation: FAB types M4, M4E, and M5 represent monocytic and myelomonocytic differentiation. The search results mention that increased expression of GLIPR1 was associated with myelomonocytic differentiation in macrophages , suggesting GLIPR1 may be part of a monocytic differentiation program.

  • Fusion protein regulation: Specific chromosomal abnormalities like t(15;17) (generating PML-RARA) or inv(16) (generating CBFB-MYH11) may directly or indirectly regulate GLIPR1 expression through altered transcriptional networks.

  • Epigenetic differences: Different AML subtypes exhibit distinct DNA methylation patterns. Given that GLIPR1 is known to be regulated by methylation in other cancers , subtype-specific methylation differences might explain expression variations.

  • Microenvironmental factors: Different AML subtypes may interact differently with the bone marrow microenvironment, potentially leading to varied GLIPR1 expression.

A comprehensive investigation would include:

  • Chromatin immunoprecipitation to identify transcription factors binding the GLIPR1 promoter in different AML subtypes

  • DNA methylation analysis of the GLIPR1 promoter across AML subtypes

  • Functional studies examining the effects of fusion proteins on GLIPR1 expression

  • Analysis of GLIPR1 expression changes during myeloid differentiation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.