Recombinant Human Glucagon-like peptide 1 receptor (GLP1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a guideline.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
GLP1R; Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-463
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNV SCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLF LYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKW MYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVLSEQ WIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLI FVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIK LFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERWRLEHLHIQRDSSMKPLKCPTSSL SSGATAGSSMYTATCQASCS
Uniprot No.

Target Background

Function
G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding initiates activation of a signaling cascade, leading to the stimulation of adenylyl cyclase and increased intracellular cAMP levels. This receptor plays a crucial role in regulating insulin secretion in response to GLP-1.
Gene References Into Functions
  1. Reviews examining GLP-1 and the spinal cord have summarized the expression of GLP-1R and the innervation of PPG neurons in the spinal cord, highlighting the potential therapeutic benefits of GLP-1R activation. PMID: 29329976
  2. Research demonstrates that the insulinotropic action of zfGIP in mammalian systems involves activation of both the GLP-1 and GIP receptors, but not the glucagon receptor. PMID: 29157578
  3. Clinical studies in non-diabetic patients with neurodegenerative disorders have shown neuroprotective effects following administration of GLP-1 receptor agonists, indicating that these effects are independent of blood glucose levels. PMID: 29412810
  4. Certain GLP-1 receptor agonists (GLP-1RA) have been approved for the treatment of type 2 diabetes mellitus (T2DM). While clinical trials may not have been designed to specifically investigate bone fracture, initial findings suggest that GLP-1RA may not exacerbate abnormal bone quality observed in T2DM. PMID: 29412811
  5. This section discusses recent findings regarding the signaling and trafficking of the GLP-1R in pancreatic beta cells. Leveraging "bias" at the receptor towards cAMP generation versus the recruitment of beta-arrestins and extracellular signal-regulated kinases (ERK1/2) activation may enable the development of novel analogues with significantly enhanced clinical efficacy. PMID: 29412835
  6. This finding might represent a potential mechanism for GLP-1R agonist-induced cardioprotection in type 2 diabetes, as increases in fatty acid oxidation and decreases in glucose oxidation are frequently observed in the hearts of animals and human subjects with T2D. PMID: 29412838
  7. In a Han Chinese population of type 2 diabetic patients, specific variations in the GLP-1R gene were associated with a lower risk of developing coronary artery disease. PMID: 30271789
  8. Activation of endogenous GLP-1 is associated with sepsis in patients with type 2 diabetes. PMID: 29334697
  9. Enhanced GLP-1R innervation in the bowel of individuals with inflammatory bowel disease (IBD) could mediate augmented visceral afferent signaling, providing a peripheral target for therapeutic intervention. PMID: 29813107
  10. GLP1R mRNA transcripts, encompassing the entire open reading frame, were detected in all four cardiac chambers from 15 hearts at levels comparable to those observed in human pancreas. PMID: 29444223
  11. Low active GLP-1 secretion is associated with hypertriglyceridaemia. PMID: 29135069
  12. This study investigated whether glucagon and glucagon-like peptide-1 (GLP-1), hormones produced by alpha cells, contribute to insulin secretion in INS-1 cells, a beta cell line. Combined treatment with glucagon and exendin-4 (Ex-4), a GLP-1 receptor agonist, additively increased glucose-stimulated insulin secretion in INS-1 cells. PMID: 29725251
  13. Genetic association studies in a Korean population suggest that SNPs in PAX4 and GLP1R are linked to type 2 diabetes (T2D) in this specific population. In genome-wide associations, PAX4 Arg192His increased the risk of T2D; GLP1R Arg131Gln decreased the risk of T2D. (PAX4 = paired box 4 protein; GLP1R = glucagon-like peptide 1 receptor) PMID: 29941447
  14. LINC01121 functions as a tumor promoter through its involvement in translational repression of the GLP1R and inhibition of the cAMP/PKA signaling pathway. PMID: 29843149
  15. Cryo-EM structure of the human GLP-1 receptor in complex with the G protein-biased peptide exendin-P5 and a Galphas heterotrimer, determined at a global resolution of 3.3 A. PMID: 29466332
  16. The data demonstrate that exendin-4 induces a partial reduction in triglycerides in steatotic hepatocytes within 12 h via the GLP-1 receptor-mediated activation of protein kinase A. Therefore, the reduction in hepatocyte triglyceride accumulation is likely driven primarily by downregulation of lipogenesis and upregulation of beta-oxidation of free fatty acids. PMID: 28707223
  17. Data (including data from studies in knockout mice) suggest that MIR204 (which is highly enriched in beta-cells) directly targets the 3'-untranslated region of GLP1R and thereby down-regulates expression of GLP1R in beta-cells. Studies were also conducted in primary human and mouse beta-cells and in a rat insulinoma cell line. PMID: 29101219
  18. Data suggest that GLP1R signaling in pancreatic beta-cells leading to insulin secretion involves interactions of GLP1R with HIP1, SNX1, and SNX27; HIP1 appears to regulate coupling of cell surface GLP1R activation with endocytosis; SNX1 and SNX27 appear to control the balance between GLP1R plasma membrane recycling and lysosomal degradation. PMID: 29284659
  19. GLP-1R was abundantly expressed in numerous regions, including the septal nucleus, hypothalamus, and brain stem. PMID: 29095968
  20. This study is the first to identify the expression of both GLP-1R and GLP-2R genes in human Epicardial adipose tissue. PMID: 28514806
  21. Changes in GLP-1 levels are associated with weight loss in newly diagnosed Chinese diabetes patients receiving acarbose. PMID: 27717194
  22. The current study revealed that overexpression of GLP1R significantly reduces proliferation, migration, and cytokine release in ASM cells from COPD patients; this involved a significant increase in ABCA1 expression levels. This provides evidence suggesting that GLP1R may be a potential therapeutic target for the treatment of COPD. PMID: 28560433
  23. IL-33, GLP-1R, and CCL20 are dysregulated in human inflammatory bowel disease. GLP-1 receptor agonists upregulate IL-33, mucin 5b, and CCL20 in murine Brunner's glands. GLP-1 receptor agonists impact gut homeostasis in both the proximal and distal parts of the gut. PMID: 27542128
  24. Data indicate that exendin-4 (Ex-4) could attenuate breast cancer cell proliferation via activation of glucagonlike peptide-1 (GLP-1) receptor (GLP-1R) and subsequent inhibition of nuclear factor kappaB (NF-kappaB) activation. PMID: 29045658
  25. Crystal structure of the full-length GLP-1 receptor bound to a truncated peptide agonist. PMID: 28562585
  26. Crystal structures of the human GLP-1R transmembrane domain in complex with two different negative allosteric modulators, PF-06372222 and NNC0640, at 2.7 and 3.0 A resolution, respectively. PMID: 28514449
  27. Data suggest that pancreatic levels of GLP1R are highest in insulin-secreting cells; here, the highest intensity of GLP1R immunostaining was observed in beta-cells in pancreatic tissues obtained from organ-donor cadavers with type 2 diabetes. PMID: 28094469
  28. Data show that purified glucagon-like peptide-1 (GLP-1) receptor (GLP1R) in nanodiscs can bind to GLP-1 and exendin-4 and activate Gs protein. PMID: 28609478
  29. Dapagliflozin, when added in real-world settings to patients with T2DM treated with GLP1-R agonists, induced a further significant, albeit modest, improvement in A1C and additional weight loss. PMID: 28077257
  30. Analysis of the biological binding site of exendin-4 peptide in the N-terminal domain of the intact human glucagon-like peptide-1 receptor. PMID: 28283573
  31. GLP1-R might represent a novel target for treating bronchial hyperresponsiveness. PMID: 27447052
  32. Studies indicate that GLP-1R is widely expressed throughout the human hypothalamus. The decreased expression of GLP-1R in the PVN and IFN of T2DM patients may be related to the dysregulation of feeding behavior and glucose homeostasis in type 2 diabetes mellitus. PMID: 26672638
  33. In conclusion, exenatide significantly improves coronary endothelial function in patients with newly diagnosed type 2 diabetes. The effect may be mediated through activation of the AMPK/PI3K-Akt/eNOS pathway via a GLP-1R/cAMP-dependent mechanism. PMID: 27072494
  34. A higher likelihood of achieving A1c goal levels was observed when a GLP-1R agonist was initiated. PMID: 28230449
  35. Immunohistochemistry of human ileum tissues was performed in this study, which showed that TAS2R38 was co-localized with glucagon-like peptide 1 (GLP-1) in enteroendocrine L-cells. PMID: 27208775
  36. Data suggest that three conserved positively charged residues located at the extracellular ends of transmembrane helices 3, 4, and 5 of GLP1R are essential for high-affinity agonist binding and conformational transitions linked to pleiotropic effector coupling through stabilization of extracellular domains. PMID: 27569426
  37. The rate of homologous desensitization and internalization of the GLP-1R has been determined in a transgenic cell line system. PMID: 28035964
  38. In glucagon-like peptide receptor (GLP-1R) expressing cells, small molecule agonists induced cAMP production but did not cause intracellular Ca2+ accumulation, ERK phosphorylation, or hGLP-1R internalization. PMID: 27100083
  39. The aim was to investigate whether genetic variations in the glucagon-like peptide receptor are associated with responses to dipepdityl peptidase-4 inhibitors in patients with type 2 diabetes. Polymorphism in the GLP-1 receptor may influence DPP-4 inhibitor response. PMID: 27858848
  40. Results suggest that pancreatic ductal adenocarcinoma (PDAC) cells or their precursor lesions do not overexpress the glucagon-like peptide-1 receptor (GLP-1R) compared with non-neoplastic pancreatic cells. PMID: 26495786
  41. Molecular dynamics simulations of wild-type and mutant GLP-1R-ligand complexes provided molecular insights into GLP-1R-specific recognition mechanisms for the N terminus of GLP-1 by residues in the 7TM pocket and explained how glucagon-mimicking GLP-1 mutants restored binding affinity for (glucagon receptor -mimicking) GLP-1R mutants. PMID: 27059958
  42. NMR-determined structure of a high-potency cyclic conformationally-constrained 11-residue analogue of GLP-1 was also docked into the receptor-binding site. PMID: 26598711
  43. No association was found between the rs6923761 GLP-1 R polymorphism and weight loss. PMID: 26015316
  44. An association was found between the rs6923761 GLP-1 receptor polymorphism and basal GLP-1 levels in diabetes mellitus type 2 patients. PMID: 25200998
  45. While GLP1R is not an independent prognostic factor in PDAC patients, it appears to have implications for pancreatic ductal adenocarcinoma metastatic ability. PMID: 26238361
  46. Retinal GLP1R expression was similar in patients with diabetes and healthy controls. PMID: 26384381
  47. A reduced level in renal arteries of hypertensive patients. PMID: 25915883
  48. These findings demonstrate that the hGLP-1R has distinct regions within the C-terminal domain required for its cell surface expression, activity, and agonist-induced internalization. PMID: 26116235
  49. The GLP-1R rs10305420 polymorphism explained some of the inter-individual differences in response to liraglutide regarding weight loss in obese PCOS women. PMID: 25991051
  50. The 168Ser (rs6923761) was nominally associated with alcohol use disorder. The 168 Ser/Ser genotype was associated with increased alcohol administration and with a higher BOLD response in the right globus pallidus. PMID: 26080318

Show More

Hide All

Database Links

HGNC: 4324

OMIM: 138032

KEGG: hsa:2740

STRING: 9606.ENSP00000362353

UniGene: Hs.351883

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of recombinant human GLP1R and how is it typically expressed for research purposes?

Recombinant human GLP1R is a member of the Class B (secretin receptor-like) family of G protein-coupled receptors (GPCRs) . For research purposes, it is typically produced as a truncated extracellular domain. Commercial preparations often consist of the N-terminal extracellular domain (approximately Ala2-Glu139) with a C-terminal polyhistidine tag to facilitate purification .

The recombinant protein is expressed using various expression systems, with mammalian cell lines being preferred when proper folding and post-translational modifications are critical. When developing recombinant GLP1R for functional studies, researchers should consider:

  • Expression system (bacterial, insect, or mammalian)

  • Affinity tags for purification (His-tag being common)

  • Glycosylation status requirements

  • Buffer conditions for stability

The functional receptor contains a large N-terminal extracellular domain connected to seven transmembrane helices with intracellular and extracellular loops, though many research applications focus on the extracellular domain alone.

How do researchers establish reliable GLP1R-expressing cell lines for in vitro studies?

Establishing reliable GLP1R-expressing cell lines involves several methodological steps:

  • Vector construction: Lentiviral vectors containing the GLP1R gene are commonly used, allowing for stable integration into the host cell genome .

  • Transduction process: Target cells (often CHO-K1 or similar cell lines) are transduced with the GLP1R lentivirus. The viral supernatant is typically collected after 3 days in serum-free media, filtered through a 0.45 μm filter, and concentrated using centrifugal protein concentration devices .

  • Selection of transduced cells: Following transduction, cells are selected using appropriate antibiotics (e.g., Geneticin/neomycin and puromycin) .

  • Validation of receptor expression: Functional validation involves treating cells with GLP1R agonists and measuring responses, such as cAMP formation or GFP reporter activation .

  • Maintenance conditions: Established cell lines are typically maintained in appropriate media (e.g., Ham's F12K supplemented with 10% fetal bovine serum) .

For researchers creating reporter cell lines, coupling GLP1R activation to a measurable output (like GFP expression driven by a cAMP response element) provides a convenient readout system for screening and functional studies .

What are the key considerations for designing GLP1R activation and binding assays?

When designing GLP1R activation and binding assays, researchers should consider:

  • Reporter systems: cAMP response element (CRE) coupled to fluorescent reporters (like GFP) provides a reliable readout for GLP1R activation .

  • Dose-response measurements: EC50 values should be determined using three-parameter dose-response curve fits with appropriate replicates. Statistical analysis typically includes calculation of 95% confidence intervals and p-values using t-tests when comparing different compounds .

  • Control selection: Commercial GLP1R agonists (like synthetic GLP-1 peptide) should be included as positive controls .

  • Sample preparation: Purified synthetic peptides should be diluted appropriately (e.g., 20× in phosphate-buffered saline) for cell treatment .

  • Data analysis considerations: Flow cytometry is commonly used to measure GFP fluorescence in reporter cells, with data exported for analysis using appropriate software (e.g., FlowJo, GraphPad Prism) .

  • Complementary assays: Beyond cAMP formation, researchers should consider measuring additional signaling outcomes such as ERK1/2 phosphorylation to gain a more complete understanding of receptor activation .

How can researchers address discrepancies between GLP1R gene expression and protein expression data?

Discrepancies between GLP1R gene and protein expression are well-documented challenges in the field. Research indicates significant inconsistencies, particularly in single-cell RNA sequencing (scRNASeq) data compared to protein-level detection . To address these discrepancies, researchers should implement a multi-modal approach:

  • Complementary detection methods: Use both mRNA detection (qRT-PCR) and protein detection (validated antibodies) in parallel .

  • Cell sorting techniques: Employ fluorescence-activated cell sorting (FACS) to isolate specific cell populations before expression analysis .

  • Reporter systems: Utilize GLP1R promoter reporter systems to monitor promoter activity alongside protein expression .

  • Validation with functional assays: Confirm receptor presence through functional responses to GLP1R agonists .

  • Consider transcript abundance: Be particularly cautious with low-abundance transcripts like GLP1R, which may be underrepresented in scRNASeq data .

Case example: Studies with GLP1R reporter mice and validated GLP1R antibodies revealed that >90% of β-cells express GLP1R protein, contradicting scRNASeq findings that suggested significant β-cell populations lack GLP1R expression . Similarly, δ-cells were found to express GLP1R mRNA but not protein, highlighting the importance of protein-level validation .

What methodological approaches are used to evaluate GLP1R-dependent signaling in different tissues?

Evaluating GLP1R-dependent signaling requires tissue-specific considerations and multiple methodological approaches:

  • Central nervous system signaling:

    • c-FOS expression analysis in specific brain nuclei (area postrema, nucleus of the solitary tract, central nucleus of the amygdala, parabrachial nuclei, and paraventricular nuclei) following peripheral administration of GLP1R agonists .

    • Behavioral assays measuring food intake following intracerebroventricular or intraperitoneal administration .

  • Pancreatic β-cell signaling:

    • Glucose-stimulated insulin secretion assays comparing wild-type and GLP1R knockout models .

    • Measurement of cAMP formation in isolated islets or β-cell lines .

  • Gastrointestinal effects:

    • Gastric emptying assays to assess GLP1R-mediated effects on gut motility .

  • Cardiovascular system:

    • Evaluations of major cardiovascular events in response to GLP1R agonists compared to other diabetes medications .

  • Multiple tissue comparison:

    • Statistical modeling approaches to compare GLP1R agonist effects across different organ systems .

Research consistently shows that effective assessment requires comparing GLP1R-mediated responses between wild-type and GLP1R knockout models to confirm receptor specificity .

How do modifications to GLP-1 peptides affect receptor binding, activation, and pharmacokinetics?

Modifications to GLP-1 peptides significantly impact their pharmacological properties:

  • Albumin fusion: Recombinant fusion of GLP-1 to albumin (e.g., Albugon) extends circulation half-life but reduces receptor activation potency. Studies demonstrate that Albugon activates GLP1R-dependent cAMP formation with a reduced EC50 (0.2 vs. 20 nmol/l) compared to the GLP1R agonist exendin-4 .

  • N-terminal modifications: The N-terminus is critical for receptor activation. Functional screening of GLP-1 variants with randomized N-terminal domains reveals that negative charges at the N-terminus often correlate with agonist activity .

  • Structure-activity relationship:

Modification TypeEffect on BindingEffect on ActivationEffect on Half-life
Albumin fusionMaintainedReduced potencySignificantly extended
N-terminal alterationsVariable depending on chargeCritical for agonismMinimal impact
DPP-4 resistance modificationsMinimal impactPreservedExtended
  • In vivo confirmation: Despite reduced in vitro potency, albumin-fused GLP-1 (Albugon) successfully decreases glycemic excursion, stimulates insulin secretion, reduces food intake, and inhibits gastric emptying in wild-type but not GLP1R knockout mice, confirming receptor specificity .

  • Computational approaches: Researchers use tools like RosettaRemodel to predict how structural modifications affect receptor interactions .

What are the emerging approaches for studying GLP1R heterogeneity in different cell populations?

Research on GLP1R heterogeneity requires sophisticated methodological approaches to address conflicting data on receptor expression patterns:

  • Single-cell RNA sequencing limitations: Current scRNASeq data suggests heterogeneous GLP1R expression among β-cells, but this conflicts with protein-level studies. Researchers must recognize that low-abundance transcripts like GLP1R may be underrepresented in scRNASeq data .

  • Multi-modal verification approach:

    • Flow cytometry with validated antibodies

    • Reporter mice (GLP1R promoter activity)

    • FACS coupled with quantitative RT-PCR

    • Functional GLP1R activation assays

  • Cell-type specific analysis: Research indicates that while >90% of β-cells express GLP1R protein, α-cells do not express GLP1R mRNA, and δ-cells express GLP1R mRNA but not protein. This necessitates cell-type specific isolation before analysis .

  • Metabolic state considerations: Studies of GLP1R expression under different metabolic conditions (e.g., in multiparous female mice) show decreased β-cell GLP1R mRNA expression without corresponding reductions in protein levels or GLP1R-mediated insulin secretion, suggesting post-transcriptional regulation .

Researchers should employ complementary approaches rather than relying solely on transcriptomic data, particularly when studying receptors with relatively low expression levels.

What is the current understanding of the comprehensive health outcomes associated with GLP1R activation?

Recent systematic evaluations of GLP1R agonists have revealed a complex profile of benefits and risks beyond glycemic control:

This comprehensive profiling provides researchers with a roadmap for investigating mechanisms behind both beneficial and adverse effects of GLP1R activation.

What computational and structural biology approaches are advancing GLP1R research?

Advanced computational and structural biology techniques are providing new insights into GLP1R function:

  • Computational structural modeling: Tools like RosettaRemodel are being employed to predict structural changes associated with ligand binding and receptor activation .

  • Structure-based drug design: Understanding the three-dimensional structure of GLP1R has enabled rational design of novel agonists with modified properties.

  • Molecular dynamics simulations: These provide insights into:

    • Receptor conformational changes upon agonist binding

    • Interactions between the receptor extracellular domain and transmembrane regions

    • Mechanisms of biased signaling

  • Systems biology approaches: Integration of large datasets from:

    • Veterans Affairs databases (n=215,970 GLP1RA users)

    • Comparative studies between different antihyperglycemic agents

    • Molecular and cellular studies

  • Statistical modeling for clinical outcomes: Advanced statistical approaches have been used to emulate clinical trials comparing GLP1R agonists with other diabetes medications, revealing superior outcomes for cardiovascular protection .

  • Network meta-analysis: Systematic review and network meta-analysis methodologies have enabled comparison of 15 different GLP1R agonists for their effects on glycemic control, body weight, and lipid profiles .

These computational approaches complement traditional experimental methods and help researchers generate hypotheses for experimental validation, particularly regarding receptor activation mechanisms and the structural basis for the differential effects of various GLP1R agonists.

How should researchers interpret the expanding therapeutic applications of GLP1R agonists beyond diabetes?

The therapeutic scope of GLP1R agonists has expanded considerably, requiring researchers to adopt a multi-system perspective:

What methodological considerations are important when comparing different GLP1R agonists in clinical research?

When designing comparative studies of GLP1R agonists, researchers should consider:

  • Network meta-analysis approaches: To compare multiple GLP1R agonists simultaneously, systematic reviews with network meta-analysis provide methodological rigor. This approach has successfully compared 15 different GLP1R agonists for their effects on glycemic control, weight reduction, and lipid profiles .

  • Multiple outcome measures: Beyond traditional HbA1c endpoints, comprehensive assessment should include:

    • Body weight changes

    • Cardiovascular outcomes

    • Lipid profiles

    • Gastrointestinal side effects

    • Quality of life measures

    • Long-term sustainability of effects

  • Statistical modeling for observational data: When randomized controlled trials are not feasible, statistical methods to emulate trials using observational data provide valuable insights. Such approaches have demonstrated superior cardiovascular outcomes with GLP1R agonists compared to other diabetes medications .

  • Large database studies with comprehensive outcome assessment: The systematic mapping of 175 health outcomes associated with GLP1R agonist use provides a model for comprehensive assessment. Such approaches have identified both expected and unexpected associations across multiple organ systems .

  • Patient stratification considerations: Not all patients respond identically to GLP1R agonists. Research designs should consider potential moderating factors such as:

    • Baseline body composition

    • Genetic factors affecting GLP1R function

    • Concurrent medications

    • Duration of diabetes

    • Presence of comorbidities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.