Recombinant Human Glucagon receptor (GCGR)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Human Glucagon Receptor (GCGR) is a class B G protein-coupled receptor (GPCR) critical for glucose homeostasis and metabolic regulation. Produced via recombinant DNA technology, this protein enables detailed structural, functional, and therapeutic studies. Its role in diabetes research and drug development has made it a focal point for biotechnological and pharmaceutical applications .

2.1. Molecular Composition

  • Amino Acid Range: Variants include Ala26-Lys136 (extracellular domain) and Met1-Phe477 (full-length transmembrane domain) .

  • Molecular Weight: Ranges from 39 kDa (glycosylated extracellular domain) to 56 kDa (full-length receptor) .

  • Post-Translational Modifications: Glycosylation and ubiquitination influence receptor trafficking and signaling .

2.2. Expression Systems

  • HEK293 Cells: Primary host for recombinant production due to efficient post-translational processing .

  • Tags: Commonly fused with human Fc (hFc) or polyhistidine (His) tags for purification and detection .

Table 1: Key Recombinant GCGR Variants

VariantExpression SystemTagPurityApplication
GCR-HM20R (Ala26-Lys136)HEK293C-hFc>95%Ligand binding studies
GCR-HM00V (Met1-Phe477)HEK293None>95%Antibody discovery
His-Tagged GCGRHEK293Polyhistidine>90%Structural biology

3.1. Signaling Pathways

  • Gs Protein Coupling: Activates adenylate cyclase, increasing cAMP and PKA activity to regulate hepatic glucose production .

  • Ubiquitination Dynamics: Constitutively ubiquitinated at the plasma membrane; deubiquitinated upon internalization for recycling .

  • β-Arrestin Recruitment: Mediates receptor desensitization and endocytosis, influencing metabolic responses .

3.2. Ligand Interactions

  • Glucagon Binding: Requires a large extracellular domain (ECD) and transmembrane "stalk" for peptide insertion .

  • Dual Agonists: Molecules like SAR425899 target both GCGR and GLP-1R, showing promise for diabetes treatment .

Table 2: Functional Domains of GCGR

DomainRoleKey Residues/Features
Extracellular DomainGlucagon bindingCys-rich region, Lys136 stalk
Transmembrane HelicesG protein couplingTM1-TM7, hydrophobic core
Intracellular Loopsβ-arrestin interactionPhosphorylation sites (Ser/Thr)

4.1. Drug Development

  • GCGR Antagonists: Improve glycemic control but risk hyperglucagonemia and α-cell hyperplasia .

  • Dual GLP-1R/GCGR Agonists: Enhance insulin secretion and promote weight loss, though GCGR occupancy remains low in humans .

5.1. Antibody Validation

  • Commercial Antibodies: Only ~10% show specificity in immunohistochemistry, complicating receptor localization studies .

  • RNA-Seq Data: Confirms GCGR mRNA prevalence in liver and kidney, with minimal expression in pancreatic β-cells .

5.2. Therapeutic Side Effects

  • Hyperglucagonemia: Linked to VGF upregulation via mTOR-STAT3 and ERK-CREB pathways in GCGR-KO models .

  • α-Cell Hyperplasia: Increases glucagon granule biogenesis and secretion, exacerbating diabetes complications .

Future Directions

  • Targeted Ubiquitination: Modulating ubiquitinase/deubiquitinase activity could fine-tune GCGR recycling and signaling .

  • Dual Receptor Agonists: Optimize GLP-1R/GCGR selectivity to balance efficacy and side effects .

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer, containing 6% Trehalose.
Form
Available in both liquid and lyophilized powder formats.
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your demand.
Lead Time
Standard lead time for this product is 3-7 business days.
Notes
Avoid repeated freezing and thawing. For optimal stability, store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life of this product is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the liquid form has a shelf life of 6 months when stored at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended to minimize repeated freeze-thaw cycles.
Tag Info
This protein is N-terminal 10xHis-tagged.
Synonyms
GCGR; Glucagon receptor; GL-R
Datasheet & Coa
Please contact us to get it.
Expression Region
26-477
Protein Length
Full Length of Mature Protein
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYL PWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQVMY TVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTRYSQK IGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFS LYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRI VQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFD LFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERNTSNHRASSSPGHGPPS KELQFGRGGGSQDSSAETPLAGGLPRLAESPF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
The Glucagon receptor (GCGR), a G-protein coupled receptor, plays a critical role in regulating blood glucose levels and maintaining glucose homeostasis. It modulates hepatic glucose production by stimulating glycogen hydrolysis and gluconeogenesis, significantly contributing to the body's response to fasting. Upon ligand binding, a conformational change is triggered, activating signaling pathways mediated by guanine nucleotide-binding proteins (G proteins). These pathways influence the activity of downstream effectors, such as adenylate cyclase, leading to its activation. Additionally, the GCGR is involved in signaling through a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. 3.0 A-resolution crystal structure of the full-length human glucagon receptor (GCGR) in complex with a glucagon analogue and partial agonist, NNC1702 PMID: 29300013
  2. Research aimed at mapping interactions between the polypeptide hormone glucagon and the glucagon receptor PMID: 28508109
  3. 3.0 A crystal structure of full-length GCGR containing both the extracellular domain and transmembrane domain in an inactive conformation PMID: 28514451
  4. These findings suggest that RAMP2 may modify the agonist activity and trafficking of the GCGR, with potential implications for the development of novel peptide analogs with selective agonist activities. PMID: 28586439
  5. Data indicate that GCGR activation proceeds through a mechanism where transmembrane helix 6 (TM6) is held in an inactive conformation by a conserved polar core and a hydrophobic lock (involving intracellular loop 3, IC3). Mutations within the corresponding polar core of GCGR disrupt these inhibitory elements, allowing TM6 to swing outward and inducing constitutive G protein signaling. PMID: 28356352
  6. The activation of the GCGR is characterized by the outward movement of the intracellular side of helix VI. In the active state of the GCGR, the Arg173(2.46)-Ser350(6.41) and Glu245(3.50)-Thr351(6.42) hydrogen bonds break, and the chi1 rotamer of Phe322(5.54) changes from perpendicular to parallel to helix VI. PMID: 27094704
  7. In the glucagon receptor (GCGR) and glucagon-like peptide-1 receptor (GLP-1R), the extracellular domain is essential for signaling even when the hormone is covalently linked to the transmembrane domain. PMID: 27226600
  8. 2.5 A crystal structure of human GCGR in complex with the antagonist MK-0893 reveals that it binds to an allosteric site outside the seven transmembrane helical bundle, positioned between TM6 and TM7 and extending into the lipid bilayer PMID: 27111510
  9. Molecular dynamics and disulfide crosslinking studies suggest that apo-GCGR can adopt both an open and closed conformation, characterized by extensive contacts between the ECD and 7TM domain. Glucagon binds to GCGR via a conformational selection mechanism. PMID: 26227798
  10. Glucagon cell adenomatosis with GCGR germline mutations appears to follow an autosomal-recessive inheritance pattern. PMID: 25695890
  11. Utilizing a real-time time-resolved FRET-based internalization assay, GLP-1R, GIPR, and GCGR were observed to internalize with distinct properties. PMID: 25451942
  12. A 3.4 A resolution crystal structure of the seven transmembrane helical domain of human GCGR, alongside a hybrid model of glucagon bound to GCGR, provides insights into the molecular recognition of the receptor for its native ligand. PMID: 23863937
  13. Letter/Case Report: nonfunctional glucagon cell adenomatosis with no detectable glucagon receptor mutations. PMID: 23407487
  14. GRA1 is a potent glucagon receptor antagonist demonstrating strong antihyperglycemic efficacy in preclinical models and notable effects on hepatic gene expression related to amino acid metabolism. PMID: 23185367
  15. F22, V23, M27, and D15 of GCGR are identified as the most crucial residues for glucagon binding. PMID: 22893257
  16. In addition to activating the classic cAMP/protein kinase A (PKA) pathway, GCGR activation also induces beta-catenin stabilization and activates beta-catenin-mediated transcription. PMID: 22438981
  17. An analysis of glucagon receptor antagonists with reduced molecular weight and lipophilicity. PMID: 22119466
  18. The P86S mutant GCGR exhibits abnormal receptor internalization & calcium mobilization, and induces apoptosis. This mutation is associated with Mahvash disease, characterized by hyperglucagonemia, hypoglycemia, and pancreatic neuroendocrine tumors. PMID: 21680267
  19. The substituted cysteine accessibility method and 3D-molecular modeling were used to study the N-terminal domain. Results indicated that Asp(63), Arg(116), and Lys(98) are critical for receptor structure and/or ligand binding. PMID: 20647307
  20. The [Ca2+] response induced by glucagon primarily occurs via the coupling of GCGR to the Galphaq/11 and Galphai/o proteins. PMID: 19903011
  21. The Gly40Ser polymorphism of the GCGR gene is linked to a higher risk of hypertension and enhanced proximal tubular sodium reabsorption. PMID: 11692154
  22. The Gly40Ser mutation in the glucagon receptor gene is not associated with type 2 diabetes in a Brazilian population, but a reduction in insulin secretion was observed in Gly40Ser carriers. PMID: 11961492
  23. Three distinct epitopes on the extracellular face of the glucagon receptor determine the specificity for the glucagon amino terminus. PMID: 12724331
  24. Expression of peroxisome proliferator-activated receptor gamma coactivator 1alpha (PGC-1alpha), known to be upregulated in the liver during fasting, was found to abolish the cAMP-dependent downregulation of glucagon receptor mRNA expression in vitro. PMID: 17374560

Show More

Hide All

Database Links

HGNC: 4192

OMIM: 138033

KEGG: hsa:2642

STRING: 9606.ENSP00000383558

UniGene: Hs.208

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is GCGR expressed across different tissues and cell types?

GCGR expression varies significantly across tissues, with highest expression observed in liver, kidney, and nerve tissue based on RNA-sequencing data from human tissues. In most other analyzed tissues, GCGR mRNA expression is minimal or absent . Within the pancreas, immunohistochemistry co-staining experiments have demonstrated GCGR presence in multiple cell types including alpha-cells (glucagon-producing), beta-cells (insulin-producing), and delta-cells (somatostatin-producing) . Researchers should employ multiple detection methods when studying tissue distribution due to GCGR's generally low expression levels.

What experimental approaches can reliably detect GCGR protein expression?

  • Autoradiography with 125I-labelled glucagon, including competition controls with excess unlabeled glucagon

  • RNA-sequencing data analysis

  • Single-cell RNA-sequencing for cellular resolution

This multi-method approach provides stronger evidence of GCGR localization than relying on antibody detection alone .

How do GCGR knockout models affect experimental interpretation?

GCGR knockout (Gcgr−/−) mice serve as essential negative controls for validating antibody specificity and studying GCGR function. Research demonstrates that GCGR antagonism via monoclonal antibodies significantly lowers blood glucose levels and increases plasma insulin in wild-type mice, effects that disappear in Glp1r−/− mice . This indicates potential cross-talk between glucagon and GLP-1 receptor systems. When designing experiments with GCGR knockout models, researchers should consider:

  • Compensatory mechanisms that develop in knockout systems

  • Potential developmental effects versus acute receptor inhibition

  • Cross-validation of findings with pharmacological approaches

How should researchers evaluate antibody specificity for GCGR detection?

Antibody validation for GCGR requires rigorous controls due to the challenges in detecting G-protein-coupled receptors (GPCRs). A comprehensive validation approach should include:

Validation MethodImplementationControl
Cell transfectionHEK293 cells transfected with mouse or human GCGR cDNANon-transfected cells
Tissue controlsLiver sections from wild-type miceGcgr−/− mice
Antibody-independent approachesAutoradiography with labeled ligandsExcess unlabeled competitor
Expression analysisRNA-sequencing dataReference genes

Researchers should report antibody validation methods in publications, as immunohistochemistry with unvalidated antibodies has led to conflicting reports about GCGR tissue distribution .

What are the optimal methods for studying GCGR-mediated signaling pathways?

GCGR primarily signals through Gs-coupled pathways to stimulate cAMP production. Advanced research into GCGR signaling should employ multiple complementary approaches:

  • In vitro GTPase assays to measure nucleotide exchange on G proteins

  • GDP dissociation rate measurements

  • cAMP accumulation assays in cell systems

  • Analysis of downstream effectors (e.g., protein kinase A substrates)

Research indicates that RAMP2 (Receptor activity-modifying protein 2) interaction with GCGR potently inhibits GCGR signaling by reducing the GDP dissociation rate from Gαs from 0.0033 s−1 to approximately 0.0001 s−1 . This demonstrates the importance of examining regulatory proteins when studying GCGR signaling mechanisms.

How can researchers effectively study GCGR/GLP-1R dual-targeting approaches?

Dual agonism of GCGR and GLP-1R has emerged as a promising therapeutic strategy for type 2 diabetes and obesity. Advanced research in this area employs:

  • Machine learning models trained on peptide sequence data with known receptor potency values

  • Multi-task neural networks with multiple loss optimization parameters

  • Model-guided sequence optimization to design peptide variants with predicted dual activity

Studies have demonstrated that model-designed sequences can achieve up to sevenfold potency improvement at both receptors simultaneously compared to previous dual-agonists . When designing experiments in this area, researchers should include appropriate controls for each receptor pathway and validate computational predictions with functional assays.

How should researchers respond to conflicting data on GCGR expression patterns?

GCGR expression, particularly in pancreatic cells, has been the subject of debate. When facing contradictory findings:

  • Systematically evaluate methodological differences between studies

  • Examine antibody specificity and validation approaches

  • Consider species differences in receptor expression

  • Employ multiple detection techniques (protein-based and mRNA-based)

  • Analyze functional data to support expression findings

The scientific literature shows that GCGR is present in multiple pancreatic cell types based on co-staining with cell-type markers, though expression levels may vary . When encountering contradictory results, researchers should thoroughly examine data discrepancies and consider alternative explanations rather than dismissing unexpected findings .

What statistical approaches are appropriate for analyzing GCGR signaling data?

Analysis of GCGR signaling requires appropriate statistical methods based on data distribution:

  • For Gaussian-distributed data: present as mean ± SEM and analyze using:

    • One-way or two-way ANOVA with appropriate post-hoc tests (Dunnett T3, Tukey, or Bonferroni)

    • Unpaired Student's t-test (two-tailed) for comparing two groups

  • For non-Gaussian distributed data: present as median (interquartile range) and analyze using:

    • Kruskal-Wallis test with Dunn multiple comparisons test

    • Mann-Whitney test (two-tailed) for comparing two groups

Statistical significance should be set at P < 0.05, and researchers should use appropriate software such as GraphPad Prism for analysis .

How does RAMP2 modulate GCGR function and what methodologies best capture this interaction?

RAMP2 has been shown to directly interact with GCGR and broadly inhibit receptor-induced downstream signaling . To study this interaction:

  • Purify monomeric RAMP2 for in vitro studies

  • Conduct time-dependent GTPase assays with and without RAMP2

  • Measure GDP dissociation rates to determine mechanism of inhibition

  • Use HDX-MS (hydrogen-deuterium exchange mass spectrometry) to identify conformational changes

Research indicates that RAMP2 enhances local flexibility in specific regions of the receptor extracellular domain (ECD), suggesting allosteric modulation . This represents an important regulatory mechanism for GCGR function that researchers should consider when designing studies.

What experimental designs best address the relationship between GCGR antagonism and β-cell regeneration?

Studies have demonstrated that GCGR antagonism using monoclonal antibodies can induce β-cell regeneration in diabetic mouse models. To research this phenomenon:

  • Use multiple diabetic models (e.g., db/db mice and T1D mice)

  • Measure metabolic parameters including fasting and random blood glucose levels

  • Quantify plasma insulin levels and pancreatic histology (β-cell area)

  • Include genetic knockout models (e.g., Glp1r−/−) to establish pathway dependence

Research shows GCGR antagonism via monoclonal antibodies increased β-cell area approximately threefold in diabetic mice, but this effect was absent in Glp1r−/− mice, indicating GLP-1R involvement . These findings suggest cross-talk between glucagon and GLP-1 signaling pathways that researchers should explicitly test in experimental designs.

How can researchers optimize dual GCGR/GLP-1R peptide agonist design?

Designing effective dual agonists presents significant challenges. Advanced researchers should:

  • Establish reliable potency measurements at both receptors

  • Train machine learning models on peptide sequence data labeled with in vitro potency values

  • Implement deep multi-task neural networks using multiple loss optimization

  • Design and test peptide variants with distinct predicted dual activity profiles

Research has demonstrated that model-designed sequences can achieve significant potency improvements at both receptors simultaneously compared to conventional approaches . Researchers should validate computational predictions with functional assays measuring receptor activation.

What considerations are important when using GCGR antibodies for tissue staining?

When using GCGR antibodies for immunohistochemistry:

  • Validate antibody specificity using both positive controls (GCGR-transfected cells) and negative controls (GCGR knockout tissues)

  • Optimize staining conditions including antigen retrieval, antibody concentration, and incubation times

  • Perform co-staining with cell-type specific markers

  • Include antibody-independent approaches to confirm findings

Research has identified ab75240 (Antibody no. 11) as having superior performance among commercially available options, but validation remains essential for each experimental context .

What are the most promising directions for GCGR research methodology?

Future GCGR research would benefit from:

  • Development of more specific and sensitive detection tools

  • Integration of structural biology approaches to understand receptor-ligand interactions

  • Single-cell analysis of GCGR signaling in native tissues

  • Advanced computational modeling of dual-receptor targeting approaches

  • Investigation of GCGR modulatory proteins beyond RAMP2

As research continues to uncover the complexities of GCGR signaling and its therapeutic potential, methodological advances will be crucial for addressing fundamental questions about receptor biology and developing targeted interventions for metabolic diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.