Recombinant Human Glucose-dependent insulinotropic receptor (GPR119)

Shipped with Ice Packs
In Stock

Description

Protein Sequence and Basic Features

The human GPR119 is a class A (rhodopsin-like) G protein-coupled receptor comprising 335 amino acids in its full-length form. The amino acid sequence is characterized by multiple transmembrane domains typical of GPCRs, with specific regions critical for ligand binding and G-protein coupling. The full amino acid sequence includes: "MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISG LLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGF VAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLL FVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTP FLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG" . This sequence is preserved in recombinant versions of the protein, though often with additional tag sequences to facilitate purification and characterization.

Expression Systems and Methods

Recombinant human GPR119 is produced using various expression systems, each with specific advantages for different research applications. The most common expression systems include:

  1. Bacterial expression (E. coli): This system is used to produce full-length human GPR119 protein with N-terminal His tags. The recombinant protein (1-335aa) can be expressed efficiently in E. coli, providing a cost-effective source of the protein for structural and biochemical studies .

  2. Insect cell expression (Baculovirus): This eukaryotic expression system offers advantages for producing proteins that require post-translational modifications. Baculovirus-expressed GPR119 may better represent the native conformation of the receptor, particularly for functional studies .

The choice of expression system depends on the specific research requirements, with E. coli being preferred for structural studies requiring large quantities of protein, and Baculovirus systems being suitable for functional studies where proper folding and post-translational modifications are critical.

Signal Transduction Pathways

GPR119 functions primarily through coupling to Gs proteins, leading to activation of adenylate cyclase and subsequent increases in intracellular cyclic AMP (cAMP) levels . This signaling cascade is fundamental to the receptor's biological effects in different tissues:

  1. In pancreatic β-cells: Elevated cAMP levels enhance glucose-dependent insulin secretion.

  2. In intestinal enteroendocrine cells: GPR119 activation stimulates the release of incretin hormones including GLP-1 and GIP, which further potentiate glucose-stimulated insulin secretion from pancreatic β-cells .

Recent research has also uncovered a role for GPR119 in α-cells, where receptor activation can stimulate glucagon secretion during hypoglycemic conditions . This finding has important implications for managing hypoglycemia in diabetes treatment.

Effects on Gut Hormone Profile

GPR119 activation has profound effects on gut hormone profiles, which are central to its metabolic actions. Studies have shown that GPR119 agonists can significantly increase plasma total PYY levels by approximately five-fold compared to placebo . In clinical studies, administration of the GPR119 agonist GSK1292263 resulted in peak PYY concentrations of approximately 50 pM after standardized meals with the 300 mg BID dose .

Interestingly, the effects of GPR119 agonists on gut hormones can be modulated by co-administration with other diabetic medications. For example:

  1. Co-dosing with metformin: Augments peak PYY concentrations to approximately 100 pM and increases post-prandial total GLP-1 levels .

  2. Co-dosing with sitagliptin (a DPP-4 inhibitor): Sitagliptin alone increases active GLP-1 but causes profound suppression of total PYY, GLP-1, and GIP. This suppression is reduced when sitagliptin is co-dosed with metformin .

These complex interactions between GPR119 agonists and other diabetes medications highlight the importance of understanding combination therapy effects in developing treatment strategies.

Therapeutic Potential

GPR119 has attracted considerable interest as a drug target for type 2 diabetes (T2D) and related metabolic disorders due to its unique mechanism of action. The receptor's activation leads to:

  1. Enhanced glucose-dependent insulin secretion from pancreatic β-cells, which helps lower blood glucose levels while minimizing the risk of hypoglycemia due to its glucose-dependent nature .

  2. Increased secretion of incretin hormones (GLP-1 and GIP) from the gut, which further enhances insulin secretion and improves glucose tolerance .

  3. Suppression of food intake and reduced body weight gain in animal models, suggesting potential benefits for obesity management .

These multifaceted effects position GPR119 agonists as potential agents for addressing multiple aspects of metabolic dysfunction in a single therapeutic approach.

Challenges in Clinical Development

Despite the promising preclinical findings, clinical development of GPR119 agonists has faced challenges. While oral administration of small molecule GPR119 agonists has been shown to improve glucose tolerance in both rodents and humans, the clinical efficacy has been modest .

For example, the GPR119 agonist GSK1292263 (GSK263) did not significantly improve glucose control in type 2 diabetic patients in clinical trials, despite having profound effects on circulating PYY levels . This suggests a gap between the receptor's theoretical potential and practical clinical outcomes that requires further investigation.

GPR119 and Hypoglycemia Counterregulation

A significant recent discovery is the role of GPR119
in glucagon secretion, particularly during hypoglycemic conditions. Research has shown that GPR119 agonists can increase glucagon secretion during low glucose conditions in isolated islets and perfused pancreata . This effect has important implications for diabetes management, as impaired glucagon secretion during insulin-induced hypoglycemia is a common problem in diabetes.

In vivo studies demonstrate that GPR119 agonists significantly increase glucagon secretion during hypoglycemia in both healthy and streptozotocin (STZ)-induced diabetic rats . Importantly, this response is absent in GPR119 knockout mice, confirming that the effect is specifically mediated through the GPR119 receptor .

Potential for Hypoglycemia Management

One of the most promising findings is that GPR119 agonists can restore impaired glucagon counterregulatory responses in diabetic rats that have been exposed to antecedent bouts of hypoglycemia . This suggests that GPR119 agonists might be repurposed to address hypoglycemia unawareness and defective counterregulation, which are serious complications of insulin therapy in diabetes.

This represents a significant shift in the therapeutic focus for GPR119 agonists. While they may have shown only modest effects in reducing hyperglycemia in T2D, their ability to augment glucagon secretion specifically during hypoglycemia could make them valuable tools for preventing severe hypoglycemic episodes in insulin-treated patients.

Fusion Proteins and Alternative Approaches

In addition to small molecule agonists, other approaches for targeting GPR119 have been explored. Drawing from techniques used with related receptors, such as the glucose-dependent insulinotropic polypeptide (GIP), fusion protein approaches might offer alternative strategies.

For example, recombinant GIP has been successfully produced using fusion protein approaches involving protein A for purification and fibrinopeptide sequences for specific cleavage . Similar approaches could potentially be applied to develop novel GPR119-based therapeutics that overcome the limitations of current small molecule agonists.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time information.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR119; Glucose-dependent insulinotropic receptor; G-protein coupled receptor 119
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISG LLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGF VAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLL FVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTP FLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG
Uniprot No.

Target Background

Function
GPR119 functions as a receptor for the endogenous fatty-acid ethanolamide oleoylethanolamide (OEA) and lysophosphatidylcholine (LPC). It also acts as a glucose-dependent insulinotropic receptor. The receptor's activity is mediated by G proteins that activate adenylate cyclase. It appears to operate through a G(s) mediated pathway.
Gene References Into Functions
  1. GPR119 is the oleoyl-lysophosphatidylinositol receptor that is essential for GLP-1 secretion in enteroendocrine cells. PMID: 29883799
  2. Angelica dahurica extract-treated cells exhibited significant increases in GPR119 activation, intracellular cAMP levels, GLP-1 levels, and glucose-stimulated insulin secretion compared to controls. PMID: 27391814
  3. This research identifies novel small-molecule GPR119 agonists with high receptor selectivity and the ability to induce glucose-stimulated insulin secretion. PMID: 24681896
  4. The GPR119 agonist, HD0471042, increased intracellular cAMP levels in stably human GPR119 expressing CHO cells. PMID: 23897163
  5. Oxidized-LDL significantly induces lincRNA-DYNLRB2-2 expression, which promotes ABCA1-mediated cholesterol efflux and inhibits inflammation through GPR119 in THP-1 cells. PMID: 24493833
  6. Replacement of the three methyl groups in 1 with metabolically stable moieties led to the identification of compound 34, a potent and efficacious GPR119 agonist with improved pharmacokinetic (PK) properties. PMID: 23648181
  7. Transfection of GLUTag cells with recombinant human GPR119 results in a constitutive and apparently ligand-independent increase of proglucagon gene promoter activity and proglucagon mRNA content. PMID: 23798572
  8. Results indicate an islet-gastrointestinal distribution of GPR119, its expression in pancreatic beta and alpha cells, and its potential involvement in islet function. PMID: 22883930
  9. Data suggest that GPR119 activation/up-regulation in skeletal muscle impairs fatty acid and glucose oxidation. Diet-induced obesity appears to up-regulate skeletal muscle GPR119. PMID: 23069642
  10. Data demonstrate that Phe-V:13 can serve as an aromatic lock for the proposed active conformation of the Trp-VI:13 rotameric switch, being involved in the global movement of TM-V and TM-VI in 7TM receptor activation. PMID: 19920139
  11. Findings show that N-oleoyldopamine (OLDA) and structurally related hydroxybenzyl amides are robust activators of GPR119. Studies indicate that multiple, distinct classes of lipid amides, acting via GPR119, may be important modulators of glucose homeostasis. PMID: 19901198
  12. GPR119 therefore presents a novel and promising potential target for the treatment of obesity and associated metabolic disorders. PMID: 16517404

Show More

Hide All

Database Links

HGNC: 19060

OMIM: 300513

KEGG: hsa:139760

STRING: 9606.ENSP00000276218

UniGene: Hs.496762

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in the pancreas, especially in the islets.

Q&A

What is GPR119 and where is it primarily expressed?

GPR119 is a cannabinoid receptor-like class A G protein-coupled receptor that belongs to the GPCR superfamily. It has been identified under various aliases including SNORF25, GPCR2, 19AJ, OSGPR116, and glucose-dependent insulinotropic receptor. The human GPR119 gene is located on chromosome X at Xp26.1 and contains a single coding exon that encodes a protein of 335 amino acids . GPR119 is primarily expressed in pancreatic β cells and intestinal enteroendocrine L cells, specifically in GLP-1-producing and GIP-producing cells . Some studies have also detected GPR119 expression in mouse liver, rat insular cortex, human brain, liver, skeletal muscle, and myocardium, though there is some controversy regarding its distribution in these tissues .

What are the main physiological functions of GPR119?

GPR119 activation produces dual physiological effects: it stimulates pancreatic secretion of insulin in a glucose-dependent manner and promotes intestinal secretion of incretin hormones (primarily glucagon-like peptide-1 [GLP-1] and glucose-dependent insulinotropic peptide [GIP]) . When activated, GPR119 causes an increase in intracellular cyclic AMP (cAMP) levels through its coupling to stimulatory G protein α-subunit (Gαs) . This signaling cascade leads to multiple metabolic effects including improved glucose tolerance, enhanced insulin secretion, reduced appetite, and positive effects on gastrointestinal motility. These functions make GPR119 particularly relevant for metabolic conditions like type 2 diabetes mellitus and obesity .

How does GPR119 differ from other GPCR family members involved in metabolic regulation?

GPR119 belongs to the biogenic amine and MECA (melanocortin, endothelial differentiation gene, cannabinoid, and adenosine) cluster of receptors . Unlike many other metabolic GPCRs, GPR119 has a distinctive structural feature—a one-amino acid shift of the conserved proline residue in TM5 that forms an outward bulge. This creates a hydrophobic cavity between TM4 and TM5 at the middle of the membrane that accommodates its endogenous ligands, which are primarily monounsaturated lipid metabolites . Additionally, while GPR119 primarily couples to Gαs proteins, research indicates it may also interact with Gαi and Gαq subunits and can engage with β-arrestin . This distinguishes GPR119 from some other metabolic GPCRs that have more restricted G protein coupling preferences.

What are the established methods for studying GPR119 activation in vitro?

Several methodologies have been developed to study GPR119 activation in vitro. A widely used approach involves live cell assays that utilize cyclic nucleotide-gated channels as biosensors for cAMP production . These assays can be implemented in high-throughput screening (HTS) formats, typically in 1536-well plates with a final assay volume of 9 μL/well . The TangoTM GPCR assay system using GPR119-bla U2OS cells has also been employed to study receptor activation . This system utilizes a beta-lactamase reporter gene to detect GPR119 activation. When testing compounds, researchers typically include unstimulated controls, stimulated controls (using known agonists like oleoylethanolamide at EC90), and cell-free controls . For robust analysis, the effects of compounds are measured both in the presence and absence of an EC10 concentration of the endogenous ligand, oleoylethanolamide, enabling detection of both agonists and potential allosteric modulators in a single assay .

How can researchers express and purify recombinant human GPR119 for structural and functional studies?

For recombinant expression of human GPR119, researchers can use bacterial expression systems similar to those employed for related proteins. Based on established methods for GPCR expression, one approach involves creating a fusion protein construct. For example, as demonstrated with GIP (which interacts with the GPR119 pathway), the human gene can be synthesized and linked to a carrier protein like Staphylococcus aureus protein A in an expression vector such as pRIT2T . This vector can then be expressed in Escherichia coli, resulting in a fusion protein that facilitates purification. The inclusion of a cleavable linker sequence, such as a thrombin cleavage site, allows for subsequent release of the target protein . For verification of the recombinant protein, researchers should employ multiple analytical methods including SDS-PAGE, ELISA, HPLC, and amino-terminal amino acid sequence analysis . Functional validation can be performed using cAMP assays or other methods that detect GPR119 signaling activity.

What controls and validation steps are essential when developing GPR119-targeted assays?

When developing GPR119-targeted assays, several critical controls and validation steps should be incorporated. First, dose-response curves with known GPR119 agonists (such as oleoylethanolamide or AR231453) are essential to establish assay sensitivity and dynamic range . Negative controls should include vehicle controls (typically DMSO at the same concentration used for compound dissolution) and known inactive compounds . Counterscreening against related receptors, particularly those that share signaling pathways (such as the glucagon receptor), is crucial to establish selectivity . Researchers should also validate their assays by determining Z' factor and signal-to-background ratios to ensure robustness and reproducibility . When optimizing assay conditions, key variables to assess include cell number, dye loading incubation time (for fluorescent assays), secondary incubation time, and DMSO tolerance . Additionally, confirmation of GPR119 expression in the cell model being used should be verified via techniques such as western blotting or RT-PCR.

What endogenous ligands activate GPR119 and how do they compare in potency?

GPR119 is activated by various endogenous ligands, primarily lipid metabolites. Among the most effective natural agonists are oleoylethanolamide (OEA) and 2-monoacylglycerols (2-MAGs), particularly 2-oleoylglycerol (2-OG) . Lysophosphatidylcholine (LPC) was the first confirmed endogenous activator of GPR119, establishing it as a de-orphanized GPCR . The potency of these ligands varies: 2-OG is considered one of the most potent endogenous activators, though its instability presents challenges for experimental use . Due to this instability, researchers have developed analogs such as 2-oleyl glyceryl to study GPR119 activation mechanisms . Comparative potency studies have revealed that when 2-OG is combined with GPR40 agonists, synergistic effects on incretin secretion can be observed, suggesting potential for combination approaches in therapeutic development . While multiple endogenous ligands have been identified, their relative potencies and tissue-specific activities continue to be areas of active investigation.

What structural features of synthetic GPR119 agonists determine their efficacy?

Structural analysis of GPR119-agonist complexes has revealed key insights into the determinants of ligand efficacy. Cryo-electron microscopy (cryo-EM) structures of human GPR119-Gs signaling complexes bound to synthetic agonists AR231453 and MBX-2982 show that despite their chemical differences, these agonists share conserved binding modes . The unique structural feature of GPR119—a one-amino acid shift of the conserved proline residue in TM5 creating an outward bulge—forms a distinctive hydrophobic cavity between TM4 and TM5 that serves as the binding site for both endogenous and synthetic ligands . Effective synthetic agonists typically contain hydrophobic moieties that can occupy this cavity. Additionally, mutagenesis studies coupled with structural analyses have identified specific receptor-ligand interaction points that are critical for agonist efficacy . These structural insights provide a foundation for rational drug design targeting GPR119, with particular emphasis on optimizing interactions with key residues in the binding pocket while maintaining drug-like properties.

How do allosteric modulators of GPR119 differ from direct agonists in their mechanism of action?

Allosteric modulators of GPR119 differ fundamentally from direct agonists in their binding sites and mechanisms of action. While direct agonists bind to the orthosteric site—the primary binding pocket evolved for endogenous ligands—allosteric modulators bind to topographically distinct sites on the receptor . These allosteric modulators can potentiate or inhibit the activity of orthosteric ligands without directly activating the receptor themselves (positive or negative allosteric modulators, respectively), or they may possess intrinsic efficacy in addition to their modulatory effects (ago-allosteric modulators) . High-throughput screening approaches have been developed specifically to identify such modulators, measuring changes in cAMP both in the presence and absence of an EC10 concentration of the endogenous ligand oleoylethanolamide . This enables detection of compounds that enhance the activity of endogenous ligands at sub-optimal concentrations. Allosteric modulators offer potential advantages including greater subtype selectivity among related receptors and the preservation of spatial and temporal aspects of natural signaling patterns.

How does the GPR119-Gs complex formation differ from other GPCR-G protein interactions?

Structural studies of the GPR119-Gs complex have revealed distinctive features that differentiate it from other GPCR-G protein interactions. Cryo-EM analyses of GPR119 bound to synthetic agonists AR231453 and MBX-2982 in complex with Gs proteins have provided molecular insights into these interactions . A notable characteristic is the salt bridge formed between intracellular loop 1 (ICL1) of GPR119 and the Gβs subunit—an interaction that proves critical for signaling, as its disruption eliminates cAMP production . This highlights an important role for the Gβs subunit in GPR119 signaling that may not be as prominent in other GPCR systems. Additionally, the one-amino acid shift of the conserved proline residue in TM5 of GPR119 creates a unique conformation of the receptor that influences both ligand binding and G protein coupling . These structural peculiarities may contribute to the specific signaling properties of GPR119 and explain some of its distinctive physiological effects compared to other metabolic GPCRs.

What molecular mechanisms underlie the incretin-stimulating effects of GPR119 activation?

The incretin-stimulating effects of GPR119 activation involve complex molecular mechanisms occurring primarily in intestinal L cells and K cells. When activated by endogenous ligands like oleoylethanolamide or synthetic agonists, GPR119 couples to Gαs proteins, leading to increased intracellular cAMP production through adenylate cyclase activation . In intestinal enteroendocrine cells, this elevated cAMP triggers signaling cascades that ultimately lead to the secretion of glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic peptide (GIP) . These incretin hormones then act on their respective receptors in pancreatic β-cells to enhance glucose-stimulated insulin secretion. GLP-1 receptor activation in pancreatic β-cells further elevates cAMP levels, potentiating glucose-induced insulin secretion through mechanisms involving enhanced calcium influx and amplification of the triggering pathway . Beyond direct effects on incretin secretion, GPR119 activation may also influence enteroendocrine cell function through effects on cell differentiation, survival, or transcriptional regulation of genes involved in incretin production . The dual action of GPR119 on both pancreatic insulin secretion and intestinal incretin release creates a potent combined effect on glucose homeostasis.

How can structural insights into GPR119 binding sites inform rational drug design?

Recent structural analyses of GPR119-Gs complexes bound to synthetic agonists have provided crucial insights for rational drug design. Cryo-EM structures revealed a distinctive binding pocket formed by a one-amino acid shift of the conserved proline residue in TM5, creating an outward bulge that opens a hydrophobic cavity between TM4 and TM5 . This cavity is particularly suited for binding monounsaturated lipid metabolites that serve as endogenous ligands . Drug designers can exploit this structural information to develop compounds that optimize interactions with this unique binding pocket. Additionally, detailed understanding of how structurally diverse agonists like AR231453 and MBX-2982 bind to the receptor despite their chemical differences provides templates for designing compounds with improved pharmacokinetic properties while maintaining efficacy . The identification of a critical salt bridge between ICL1 of GPR119 and Gβs offers another potential target for drug design—compounds that stabilize or mimic this interaction might enhance G protein coupling efficiency . Structure-based virtual screening methods incorporating these insights can accelerate the discovery of novel GPR119 modulators with improved specificity and reduced off-target effects.

What experimental approaches can distinguish between different signaling pathways activated by GPR119?

To distinguish between different signaling pathways activated by GPR119, researchers can employ a variety of sophisticated experimental approaches. BRET (Bioluminescence Resonance Energy Transfer) or FRET (Fluorescence Resonance Energy Transfer) assays can monitor the recruitment of different G protein subtypes (Gαs, Gαi, Gαq) or β-arrestin to GPR119 in real-time following stimulation with various ligands . Pathway-specific inhibitors can help delineate the contribution of different signaling cascades: PKA inhibitors (e.g., H-89) for Gαs-cAMP-PKA pathway, pertussis toxin for Gαi pathways, or PLC inhibitors for Gαq pathways. CRISPR-Cas9 knockout or siRNA knockdown of specific signaling components can further validate their roles in GPR119 signaling. Biased ligands—compounds that preferentially activate one signaling pathway over others—are particularly valuable tools; researchers can screen for such ligands using parallel assays measuring different signaling outputs (cAMP production, calcium mobilization, ERK phosphorylation, β-arrestin recruitment) . Phosphoproteomic analyses after GPR119 activation with different ligands can provide comprehensive views of activated signaling networks. These approaches collectively enable researchers to construct detailed maps of GPR119 signaling pathways and identify ligand-specific signaling profiles.

What techniques are most effective for studying GPR119 function in complex physiological systems?

Studying GPR119 function in complex physiological systems requires integrated approaches that bridge molecular mechanisms with whole-organism physiology. Tissue-specific conditional knockout models using Cre-lox technology allow researchers to delete GPR119 in specific cell types (β-cells, L-cells) to dissect its role in different tissues . CRISPR-Cas9 gene editing can introduce specific mutations identified in structural studies to test their physiological relevance . For dynamic studies of GPR119 activity in vivo, chemogenetic approaches using designer receptors exclusively activated by designer drugs (DREADDs) based on GPR119 can provide temporal control over receptor activation. Metabolic phenotyping using hyperinsulinemic-euglycemic clamps, oral glucose tolerance tests, and mixed meal tests in these models provides functional readouts . Ex vivo systems like perfused pancreas or intestinal organoids maintain tissue architecture while allowing controlled experimental manipulation . For translational relevance, humanized mouse models expressing human GPR119 can address species differences. Combining these techniques with 'omics approaches (transcriptomics, proteomics, metabolomics) offers comprehensive views of how GPR119 modulation affects metabolic networks across multiple tissues, providing insights that cannot be obtained from simplified in vitro systems.

How can researchers reconcile contradictory findings about GPR119 tissue distribution patterns?

Contradictory findings regarding GPR119 tissue distribution present a significant challenge for researchers. To reconcile these discrepancies, a multi-method validation approach is essential. When examining GPR119 expression, researchers should employ complementary detection methods including RT-qPCR, in situ hybridization, immunohistochemistry with validated antibodies, and newer techniques like RNAscope or single-cell RNA sequencing . Each method has strengths and limitations, and concordance across multiple techniques provides stronger evidence of expression. Researchers should carefully consider the specificity of detection reagents—particularly antibodies, which may exhibit cross-reactivity with related proteins. Species differences should be explicitly acknowledged, as GPR119 distribution may vary between humans and experimental models . The sensitivity of detection methods is also critical, as low-level expression might be detected by highly sensitive techniques like PCR but missed by less sensitive methods. Additionally, receptor expression may be dynamic and influenced by physiological states, age, or disease conditions . Published studies have reported conflicting findings regarding GPR119 expression in tissues like the brain, liver, and skeletal muscle . When presenting new distribution data, researchers should directly address these contradictions and discuss potential methodological or biological explanations for discrepancies.

What factors contribute to variability in GPR119 agonist efficacy between different experimental systems?

Multiple factors can contribute to variability in GPR119 agonist efficacy across experimental systems. Expression levels of GPR119 itself vary significantly between cell lines and primary tissues, directly impacting apparent agonist potency and efficacy . The composition of the cellular signaling machinery, including G protein subtypes, adenylyl cyclase isoforms, phosphodiesterases, and β-arrestins, differs between systems and influences downstream responses . Post-translational modifications of GPR119 may vary between expression systems, affecting ligand binding or receptor coupling efficiency. Experimental conditions including buffer composition, temperature, incubation times, and cellular metabolic state can significantly influence assay outcomes . For lipid-based agonists, solubility issues and binding to serum proteins or plasticware can cause apparent potency shifts . The readout method selected (direct cAMP measurement, reporter genes, or downstream physiological effects) introduces additional variability . Species differences are particularly notable—compounds may exhibit different potencies at human versus rodent GPR119 orthologues . When comparing results across studies, researchers should carefully account for these variables and standardize conditions wherever possible. For therapeutic development, understanding these sources of variability is essential to predict how compounds might translate from in vitro systems to clinical efficacy.

What are the current limitations in translating findings from GPR119 preclinical studies to clinical applications?

Translating GPR119 findings from preclinical studies to clinical applications faces several important limitations. Species differences in GPR119 sequence, expression patterns, and signaling represent a primary challenge—human GPR119 shares only 82% and 73.7% amino acid identity with mouse and rat GPR119, respectively . These differences may affect ligand binding properties and downstream signaling efficacy. The complex physiological context in which GPR119 operates—involving multiple tissues and interacting metabolic pathways—is difficult to fully recapitulate in simplified experimental systems . Many preclinical studies focus on acute effects of GPR119 activation, while therapeutic applications require understanding of long-term consequences and potential compensatory mechanisms. The pharmacokinetics of GPR119 agonists present challenges, as many compounds show poor bioavailability or rapid clearance in vivo . Loss of efficacy over time has been observed with several lead compounds, suggesting potential receptor desensitization or tolerance mechanisms that require further investigation . Additionally, significant toxic side effects have emerged with some GPR119 modulators in development . The incretin-stimulating effects of GPR119 activation may vary substantially between healthy individuals and patients with metabolic disorders due to differences in enteroendocrine cell function or sensitivity . These challenges highlight the need for improved preclinical models and translational biomarkers to better predict clinical outcomes of GPR119-targeted therapeutics.

What research gaps need to be addressed to advance GPR119-targeted drug development?

Several critical research gaps must be addressed to advance GPR119-targeted drug development. A more comprehensive understanding of the tissue-specific roles of GPR119 in different metabolic states and disease conditions is needed . The molecular basis for the reported loss of efficacy with some GPR119 agonists requires investigation, focusing on potential receptor desensitization mechanisms or compensatory pathways . Improved understanding of structure-activity relationships is essential for developing compounds with optimized pharmacokinetic properties while maintaining target engagement . More detailed characterization of signaling bias among different GPR119 ligands may reveal connections between specific signaling pathways and therapeutic or adverse effects . Development of biomarkers that predict clinical response to GPR119 modulators would facilitate patient selection in clinical trials. Research into combination approaches with other anti-diabetic agents could identify synergistic pairs that maximize efficacy while minimizing side effects . Long-term safety studies are needed to address concerns about potential off-target effects on non-metabolic tissues expressing GPR119 . The identification and characterization of GPR119 genetic variants in human populations may help explain variability in drug response. Finally, specialized drug delivery approaches that optimize exposure at primary sites of action (pancreas, intestine) while limiting systemic distribution could improve therapeutic index.

What are the most promising strategies for developing selective GPR119 modulators with improved safety profiles?

Developing selective GPR119 modulators with improved safety profiles requires innovative strategies informed by recent structural and pharmacological insights. Structure-guided drug design leveraging the cryo-EM structures of GPR119-Gs complexes can identify compounds that optimize interactions with the unique binding pocket while minimizing engagement with off-target receptors . Exploration of biased ligands that selectively activate beneficial signaling pathways (e.g., cAMP production) while minimizing pathways associated with adverse effects may improve therapeutic index . Allosteric modulators offer particular promise, as they can fine-tune receptor activity while maintaining physiological regulation patterns and potentially achieving greater receptor subtype selectivity . Development of prodrugs that are preferentially activated in target tissues could reduce systemic exposure and associated side effects. Dual-targeted approaches that modulate both GPR119 and complementary receptors (like GPR40) at lower doses than would be required for each target individually might achieve efficacy with reduced off-target effects . The application of high-throughput screening methods that simultaneously assess compound activity against GPR119 and potential off-target receptors can identify selective leads early in development . Leveraging medicinal chemistry to improve physicochemical properties while maintaining target selectivity is essential for overcoming the pharmacokinetic challenges that have limited previous development efforts . These multi-faceted approaches collectively offer pathways to develop GPR119 modulators with improved safety profiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.