Recombinant Human Glycerol-3-phosphate acyltransferase 3 (AGPAT9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
GPAT3; AGPAT9; MAG1; HMFN0839; UNQ2753/PRO6492; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Acyl-CoA:glycerol-3-phosphate acyltransferase 3; hGPAT3; Lung cancer metastasis-associated protein 1; Lysophosphatidic acid acyltransferase theta; LPAAT-theta; MAG-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GPAT3
Target Protein Sequence
MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKE SILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE LVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQ LPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTT DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILI FPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSW AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQ KNYSKMIVGNGSLS
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of glycerol-3-phosphate to 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) by acylating the sn-1 position of the glycerol backbone. It also converts LPA to 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by acylating the sn-2 position.
Gene References Into Functions
  1. AGPAT9 inhibits cell growth in breast cancer by modulating the expression of KLF4/LASS2/V-ATPase proteins. [PMID: 26110566](https://www.ncbi.nlm.nih.gov/pubmed/26110566)
  2. Studies have revealed a direct role for mag-1 in metastasis and its contribution to cellular adaptation within the tumor microenvironment. [PMID: 22985252](https://www.ncbi.nlm.nih.gov/pubmed/22985252)
  3. Research indicates a link between insulin's lipogenic effects and microsomal GPAT3 and GPAT4, highlighting their significance in glycerolipid biosynthesis. [PMID: 20181984](https://www.ncbi.nlm.nih.gov/pubmed/20181984)
  4. The LPAAT-theta gene, comprising 12 exons and 11 introns, is located on chromosome 4q21.23 and exhibits ubiquitous expression across 18 human tissues. Overexpression of LPAAT-theta induces mTOR-dependent p70S6K and 4EBP1 phosphorylation in HEK293T cells. [PMID: 17002884](https://www.ncbi.nlm.nih.gov/pubmed/17002884)
Database Links

HGNC: 28157

OMIM: 610958

KEGG: hsa:84803

STRING: 9606.ENSP00000264409

UniGene: Hs.99196

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Expressed in liver, kidney, testis, brain, heart, skeletal muscle, thyroid, prostate, thymus and placenta. Also expressed lung and adipose tissue.

Q&A

What is the primary function of AGPAT9 in cellular metabolism?

AGPAT9, also known as LPCAT1 (lysophosphatidylcholine acyltransferase 1), is a key enzyme that catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol . The enzyme plays crucial roles in lipid biosynthesis pathways and membrane remodeling processes. It functions primarily in the initial steps of the glycerolipid biosynthetic pathway, which is essential for maintaining cellular membrane integrity and energy storage.

AGPAT9 has multiple physiological roles, including participation in the non-inflammatory platelet-activation factor remodeling pathway and maintenance of retinal photoreceptor homeostasis . The enzyme is particularly important in tissues with high lipid metabolism requirements, explaining its elevated expression in specific organs.

How is AGPAT9 expression distributed across different tissues?

AGPAT9 demonstrates a tissue-specific expression pattern with significant implications for its physiological functions:

Tissue/OrganRelative AGPAT9 Expression Level
LungVery high
SpleenVery high
LeukocytesHigh
Adipose tissue (omental)Moderate to high
PlacentaModerate to high
Breast tissueVariable (cell-type dependent)

This differential expression pattern suggests tissue-specific roles for AGPAT9 in lipid metabolism and cellular function . When designing experiments to study AGPAT9, researchers should consider these expression patterns to select appropriate tissue models that naturally express the enzyme at physiologically relevant levels.

How do I distinguish between AGPAT9 and related acyltransferases in experimental settings?

Distinguishing AGPAT9 from other related enzymes requires a multifaceted approach combining molecular, biochemical, and functional analyses:

  • Molecular identification: Use gene-specific primers designed for unique regions of AGPAT9 for RT-PCR and qPCR assays. Sequence verification is essential for confirming specificity.

  • Protein detection: Employ validated antibodies that recognize specific epitopes of AGPAT9 not shared with other family members. Western blotting with careful attention to molecular weight (~60 kDa) can help distinguish from related proteins.

  • Substrate specificity assessment: AGPAT9 has a preference for certain acyl-CoA species that differs from other family members. Enzymatic assays measuring incorporation rates of different acyl-CoA donors can help differentiate AGPAT9 activity.

  • Inhibition profiles: Selective inhibitors, though limited, can help differentiate between acyltransferase activities when used in careful dose-response experiments.

  • Expression knockdown validation: When using siRNA or shRNA approaches, verify specificity by measuring expression of multiple family members to confirm selective targeting.

When reporting results, always specify the experimental methods used for identification to ensure reproducibility and proper interpretation by the scientific community .

What cell models are most appropriate for studying AGPAT9 function in cancer research?

Based on current evidence, the following cell models offer distinct advantages for AGPAT9 research in cancer biology:

Cell LineCharacteristicsAppropriate Research Applications
MCF7Poorly invasive breast cancer cells with relatively high AGPAT9 expressionBaseline studies, loss-of-function experiments, mechanistic studies of tumor suppression
MDA-MB-231Highly invasive breast cancer cells with low AGPAT9 expressionGain-of-function experiments, metastasis studies, aggressive phenotype analysis
MCF7/ADRDrug-resistant derivative with reduced AGPAT9 expressionChemoresistance mechanisms, drug sensitivity modulation studies
Normal breast epithelial cells (e.g., MCF10A)Non-cancerous controlComparative studies, normal vs. pathological function analysis

When designing experiments, researchers should consider:

  • The inverse correlation between AGPAT9 expression and invasiveness in breast cancer models

  • The dramatic expression differences (up to 240-fold) between drug-resistant and drug-sensitive cell lines

  • The need for matched control cell lines for proper experimental comparison

  • The potential confounding effects of V-ATPase expression levels in selected cell models

Cell models should be regularly authenticated and assessed for AGPAT9 expression levels before experimentation to ensure consistent results . While breast cancer models have been most extensively studied, researchers investigating other cancer types should validate AGPAT9 expression in their specific models before proceeding with functional studies.

How can I establish reliable AGPAT9 overexpression and knockdown models?

Establishing reliable genetic models for AGPAT9 functional studies requires careful consideration of several methodological factors:

For overexpression models:

  • Vector selection: Lentiviral vectors have proven effective for AGPAT9 transfection in breast cancer cell lines, providing stable long-term expression .

  • Promoter considerations: Use constitutive promoters (e.g., CMV) for consistent expression or inducible systems (e.g., Tet-On) when temporal control is needed.

  • Expression verification: Confirm overexpression at both mRNA level (qRT-PCR) and protein level (Western blot) compared to vector-only controls.

  • Functional validation: Verify altered enzymatic activity using AGPAT activity assays to confirm the expressed protein is functional.

  • Clonal selection: When possible, isolate and characterize multiple clones to account for clonal variation effects.

For knockdown models:

  • RNAi approach options: Both transient siRNA and stable shRNA approaches have been successfully used for AGPAT9 knockdown in MCF7 cells .

  • Target sequence selection: Design multiple targeting sequences within the AGPAT9 coding region, avoiding regions with homology to other AGPAT family members.

  • Knockdown validation: Quantify remaining AGPAT9 expression at both mRNA and protein levels, with effective knockdown typically showing >70% reduction.

  • Off-target effect control: Include scrambled sequence controls and rescue experiments with RNAi-resistant AGPAT9 constructs to confirm specificity.

For both models, maintain parallel passage of experimental and control cell lines to minimize passage-dependent variations. Regular authentication of cell lines and periodic revalidation of expression levels are essential for experimental reproducibility .

What are the optimal methods for measuring AGPAT9 enzymatic activity?

Accurate measurement of AGPAT9 enzymatic activity requires careful selection of experimental conditions:

Standard in vitro AGPAT activity assay:

  • Sample preparation: Prepare microsomal fractions from cells or tissues expressing AGPAT9 through differential centrifugation.

  • Substrate preparation: Use radiolabeled glycerol-3-phosphate (G3P) and acyl-CoA donors matched to AGPAT9 preference.

  • Reaction conditions: Optimize buffer composition (typically phosphate buffer, pH 7.4), divalent cation concentration (Mg²⁺), and temperature (37°C).

  • Product detection: Separate lysophosphatidic acid product by thin-layer chromatography and quantify by scintillation counting.

  • Controls: Include heat-inactivated enzyme preparations and specific inhibitors as negative controls.

Alternative approaches:

  • Fluorescent substrate assays: Non-radioactive methods using BODIPY or NBD-labeled substrates with HPLC separation.

  • Mass spectrometry-based approaches: LC-MS/MS quantification of product formation for higher sensitivity and specificity.

  • Coupled enzymatic assays: Monitoring AGPAT9 activity through linked reactions and spectrophotometric detection.

Important considerations:

  • Verify assay linearity with respect to protein concentration and reaction time

  • Control for competing enzymatic activities in crude preparations

  • Establish substrate saturation curves to determine kinetic parameters (Km, Vmax)

  • Include appropriate positive controls (e.g., commercial recombinant AGPAT9)

Enzymatic activity should be normalized to protein concentration or to AGPAT9 expression level when comparing between different experimental conditions or cell types .

How does AGPAT9 expression impact breast cancer progression and metastasis?

AGPAT9 demonstrates significant tumor-suppressive properties in breast cancer models through multiple mechanisms:

Anti-proliferative effects:

  • AGPAT9 significantly inhibits breast cancer cell proliferation both in vitro and in in vivo xenograft models .

  • The inhibitory effect correlates with expression level, with forced expression in low-AGPAT9 cells (MDA-MB-231) reducing proliferation rates.

  • Knockdown of AGPAT9 in high-expressing cells (MCF7) enhances proliferative capacity.

Anti-metastatic properties:

  • Live-cell imaging and transwell assays demonstrate that AGPAT9 significantly inhibits migration and invasion capabilities of breast cancer cells .

  • In vivo lung metastasis models confirm reduced metastatic capacity in AGPAT9-overexpressing cells.

  • Expression patterns in clinical samples show inverse correlation between AGPAT9 levels and metastatic potential.

Mechanistic insights:

  • AGPAT9 expression is markedly higher in poorly invasive MCF7 cells compared to highly invasive MDA-MB-231 cells .

  • The anti-cancer effects appear to involve both lipid metabolism alterations and signaling pathway regulation.

  • Expression analysis reveals AGPAT9 as a potential biomarker for distinguishing aggressive from less aggressive breast cancer phenotypes.

These findings suggest that AGPAT9 acts as a tumor suppressor in breast cancer, with potential diagnostic and therapeutic implications . The consistent anti-cancer effects across multiple experimental systems provide strong evidence for its biological significance in cancer progression.

What molecular mechanisms underlie AGPAT9's tumor-suppressive effects?

AGPAT9 exerts its tumor-suppressive functions through several interconnected molecular pathways:

Regulation of transcription factors:

  • AGPAT9 overexpression significantly increases KLF4 mRNA levels (p = 0.0011) and protein expression .

  • KLF4 is a known tumor suppressor in breast cancer that inhibits cell proliferation, migration, and invasion.

  • Chromatin immunoprecipitation (ChIP) assays confirm that KLF4 directly binds to the promoter region of downstream targets.

LASS2 pathway activation:

  • AGPAT9 expression leads to significant upregulation of LASS2 mRNA (p = 0.0090) and protein .

  • LASS2 is a direct transcriptional target of KLF4, establishing a mechanistic pathway: AGPAT9 → KLF4 → LASS2.

  • LASS2 binds to ATP6V0C (a subunit of V-ATPase proton pump), inhibiting its activity.

V-ATPase inhibition cascade:

  • AGPAT9 overexpression significantly reduces V-ATPase activity (p = 0.0351) .

  • This inhibition leads to decreased proton secretion, resulting in:

    • Increased extracellular pH (reduced tumor acidic microenvironment)

    • Decreased intracellular pH

  • These pH alterations are critical for creating an unfavorable environment for cancer progression.

Matrix metalloproteinase regulation:

  • AGPAT9 significantly decreases active MMP-2 (p = 0.0111) and MMP-9 (p = 0.0202) levels in the extracellular environment .

  • Reduced MMP activity limits extracellular matrix degradation, a key step in invasion and metastasis.

  • This effect may be partly mediated through pH-dependent regulation of MMP activation.

Wnt/β-catenin pathway modulation:

  • Preliminary evidence indicates AGPAT9 may influence Wnt signaling components .

  • Further research is needed to fully characterize this potential mechanism.

The multilevel molecular effects of AGPAT9 suggest it functions as a master regulator of multiple cancer-related pathways, making it a promising target for therapeutic intervention .

How does AGPAT9 influence chemosensitivity in breast cancer cells?

AGPAT9 demonstrates significant effects on chemotherapeutic response in breast cancer models:

Expression correlation with drug resistance:

  • AGPAT9 expression is dramatically decreased (240.4-fold, p = 0.0006) in drug-resistant MCF7/ADR cells compared to drug-sensitive MCF7 cells .

  • This substantial difference suggests AGPAT9 downregulation may be a key mechanism in acquired drug resistance.

Doxorubicin sensitivity modulation:

  • Overexpression of AGPAT9 in MCF7/ADR cells significantly reduced the IC₅₀ value for doxorubicin (p = 0.0146) .

  • This indicates that restoring AGPAT9 expression can partially reverse the drug-resistant phenotype.

Subcellular drug distribution effects:

  • In sensitive MCF7 cells, doxorubicin localizes primarily in nuclei where it exerts cytotoxic effects .

  • In resistant MCF7/ADR cells, doxorubicin remains in cytoplasmic compartments, reducing efficacy.

  • AGPAT9 overexpression in MCF7/ADR cells restores nuclear localization of doxorubicin.

Potential mechanisms:

  • pH gradient alteration: By inhibiting V-ATPase activity, AGPAT9 may disrupt pH gradients that cause ion trapping of weakly basic drugs like doxorubicin in acidic compartments.

  • Drug transporter modulation: AGPAT9 may influence the expression or activity of drug efflux transporters like P-glycoprotein.

  • Membrane composition changes: As a lipid-modifying enzyme, AGPAT9 could alter membrane properties affecting drug penetration and retention.

Methodological considerations for chemosensitivity studies:

  • Use multiple drug concentrations to generate complete dose-response curves rather than single-point measurements

  • Include appropriate vehicle controls to account for solvent effects

  • Employ multiple assays for cell viability/cytotoxicity to confirm results (e.g., MTT, SRB, ATP assays)

  • Validate findings with multiple chemotherapeutic agents to determine specificity

These findings highlight AGPAT9 as a potential target for overcoming chemoresistance in breast cancer treatment . The dramatic effects on drug sensitivity suggest combination approaches targeting AGPAT9 expression or function could enhance therapeutic efficacy.

How does AGPAT9 regulate tumor microenvironment acidity?

AGPAT9 plays a crucial role in modulating the acidic tumor microenvironment through its effects on proton transport:

V-ATPase activity regulation:

  • Overexpression of AGPAT9 in MDA-MB-231 cells significantly reduces V-ATPase activity (p = 0.0351) .

  • Conversely, AGPAT9 knockdown in MCF7 cells significantly increases V-ATPase activity (p = 0.0496) .

  • This establishes AGPAT9 as a negative regulator of V-ATPase function.

Mechanistic pathway:

  • AGPAT9 upregulates LASS2 expression at both mRNA and protein levels .

  • LASS2 physically interacts with ATP6V0C, the c subunit of V-ATPase proton pump.

  • This interaction inhibits the proton-pumping function of V-ATPase.

Effects on cellular pH regulation:

  • Proton secretion, measured using pH-sensitive BCECF, is notably reduced in AGPAT9-overexpressing cells .

  • This results in measurable changes to both extracellular and intracellular pH.

  • The pH alterations create a less favorable environment for cancer cell invasion and metastasis.

Experimental approaches for studying pH effects:

  • Extracellular pH (pHe) measurement: Use calibrated pH electrodes or pH-sensitive fluorescent probes in conditioned media.

  • Intracellular pH (pHi) measurement: Employ ratiometric fluorescent dyes (BCECF-AM) with microscopy or flow cytometry.

  • Proton flux quantification: Track dynamic changes in media pH over time to measure proton extrusion rates.

  • V-ATPase activity assays: Measure ATP hydrolysis and proton transport in isolated membrane vesicles.

Methodological considerations:

  • Control for cell density when measuring pH changes

  • Carefully buffer culture media to allow detection of subtle pH changes

  • Include positive controls (V-ATPase inhibitors like Bafilomycin A1) and negative controls

  • Account for potential compensatory mechanisms that maintain cellular pH homeostasis

These findings highlight a novel role for AGPAT9 in regulating tumor microenvironment acidity, a key factor in cancer progression . Understanding this mechanism provides potential avenues for therapeutic intervention targeting cancer-specific pH regulation.

What is the relationship between AGPAT9 and matrix metalloproteinase regulation?

AGPAT9 demonstrates significant regulatory effects on matrix metalloproteinases (MMPs), key enzymes in cancer invasion and metastasis:

Quantitative effects on MMP activity:

  • AGPAT9 overexpression in MDA-MB-231 cells significantly decreases active MMP-2 levels (p = 0.0111) and active MMP-9 levels (p = 0.0202) in cell culture supernatants .

  • Conversely, AGPAT9 knockdown in MCF7 cells significantly increases active MMP-2 (p = 0.0097) and MMP-9 (p = 0.0027) levels .

  • These consistent bidirectional effects confirm AGPAT9 as a negative regulator of MMP activation.

Potential regulatory mechanisms:

  • pH-dependent regulation: MMPs require specific pH conditions for optimal activity and activation. AGPAT9's effects on V-ATPase and extracellular pH may create suboptimal conditions for MMP function.

  • Transcriptional control: AGPAT9 may influence transcription factors (potentially through KLF4) that regulate MMP gene expression.

  • TIMP modulation: AGPAT9 could alter the balance between MMPs and their endogenous inhibitors (tissue inhibitors of metalloproteinases, TIMPs).

  • Secretory pathway effects: As a membrane lipid-modifying enzyme, AGPAT9 might influence vesicular trafficking and secretion of MMPs.

Experimental approaches for MMP studies:

  • Zymography: Gelatin or casein zymography for detecting MMP-2/9 activity in conditioned media

  • ELISA-based activity assays: Quantitative measurement of active MMP levels using specific antibodies

  • Fluorogenic substrate assays: Real-time monitoring of MMP activity using quenched fluorescent peptides

  • In situ zymography: Visualization of MMP activity in cellular context

Table: AGPAT9 Effects on MMP Expression and Activity

ConditionActive MMP-2Active MMP-9Effect on Invasion
AGPAT9 overexpression in MDA-MB-231Decreased (p=0.0111)Decreased (p=0.0202)Reduced
AGPAT9 knockdown in MCF7Increased (p=0.0097)Increased (p=0.0027)Enhanced

The regulation of MMP activity by AGPAT9 provides a mechanistic explanation for its effects on cancer cell invasion and metastasis . This relationship suggests potential therapeutic strategies targeting this pathway to modulate cancer progression.

How can contradictions in AGPAT9 research findings be reconciled?

Researchers studying AGPAT9 may encounter seemingly contradictory findings across different experimental systems. These contradictions can be systematically analyzed and potentially reconciled through the following methodological approaches:

Common sources of contradictory findings:

  • Cell type-specific effects:

    • AGPAT9 functions differently in various cell types due to different molecular contexts

    • Example: AGPAT9 shows tumor-suppressive effects in breast cancer cells but may have different roles in other tissues

  • Experimental technique variations:

    • Different methods for modulating AGPAT9 expression (transient vs. stable, knockdown vs. knockout)

    • Varying sensitivity and specificity of detection methods

  • Isoform confusion:

    • AGPAT9 (also called LPCAT1) is part of a larger enzyme family with overlapping functions

    • Inconsistent nomenclature across studies can lead to apparent contradictions

Systematic reconciliation approach:

  • Direct comparative studies:

    • Analyze multiple cell types under identical experimental conditions

    • Example finding: AGPAT9 expression is high in poorly invasive MCF7 cells but low in highly invasive MDA-MB-231 cells

  • Pathway context analysis:

    • Map relationships between AGPAT9 and interacting partners across systems

    • The AGPAT9→KLF4→LASS2→V-ATPase pathway may be intact in some systems but disrupted in others

  • Dose-response relationships:

    • Effects may vary with expression level, with different thresholds for various functions

    • Quantitative rather than qualitative analysis may resolve apparent contradictions

  • Temporal considerations:

    • Short-term vs. long-term effects of AGPAT9 modulation may differ

    • Adaptive responses may compensate for AGPAT9 changes over time

Methodological recommendations:

  • Use multiple complementary techniques to measure the same parameter

  • Include appropriate positive and negative controls in all experiments

  • Validate key findings across multiple cell lines and experimental systems

  • Consider both gain-of-function and loss-of-function approaches

  • Report quantitative data with appropriate statistical analysis

By systematically addressing these factors, researchers can develop more nuanced models of AGPAT9 function that accommodate apparently contradictory findings across different experimental systems .

What are the optimal experimental designs for studying AGPAT9's role in cancer progression?

Optimal experimental design for AGPAT9 cancer research requires multilevel approaches that integrate in vitro, in vivo, and clinical investigations:

In vitro cellular models:

  • Paired isogenic systems: Create matched cell lines differing only in AGPAT9 expression

    • Use lentiviral vectors for stable overexpression in low-expressing cells (e.g., MDA-MB-231)

    • Apply siRNA or shRNA for knockdown in high-expressing cells (e.g., MCF7)

    • Include vector-only and scrambled sequence controls

  • Functional assays selection:

    • Proliferation: Colony formation, MTT/XTT assays, BrdU incorporation

    • Migration: Wound healing, transwell migration without matrigel

    • Invasion: Matrigel-coated transwell, 3D spheroid invasion assays

    • Drug sensitivity: Dose-response curves with multiple measurement timepoints

  • 3D culture systems:

    • Spheroid formation in low-attachment conditions

    • Organoid cultures that better mimic tissue architecture

    • Co-culture with stromal components to assess microenvironment interactions

In vivo models:

  • Xenograft approaches:

    • Orthotopic implantation (e.g., mammary fat pad for breast cancer models)

    • Metastatic models with tail vein injection for lung colonization assessment

    • Patient-derived xenografts for clinical relevance

  • Monitoring techniques:

    • Bioluminescence imaging for longitudinal tumor growth tracking

    • Ex vivo analysis of tumor characteristics (growth, histology, molecular markers)

    • Assessment of metastatic burden in relevant organs

Molecular mechanism investigation:

  • Pathway validation approaches:

    • Rescue experiments to confirm mechanistic links

    • Inhibitor studies targeting specific pathway components (e.g., V-ATPase inhibitors)

    • Epistasis analysis with simultaneous manipulation of multiple pathway elements

  • Temporal dynamics assessment:

    • Inducible expression systems for controlled timing of AGPAT9 modulation

    • Time-course experiments to distinguish primary from secondary effects

Clinical correlation:

  • Tissue microarray analysis: Correlate AGPAT9 expression with clinical parameters in patient samples

  • Meta-analysis: Integrate findings across multiple studies and cancer types

  • Prognostic value assessment: Correlate expression with survival outcomes

By implementing these multilevel experimental approaches, researchers can develop a comprehensive understanding of AGPAT9's role in cancer progression that integrates molecular mechanisms with physiological relevance .

What statistical approaches are most appropriate for analyzing AGPAT9 expression data?

For continuous AGPAT9 expression data:

  • Parametric tests (when normality assumptions are met):

    • Student's t-test for comparing two groups (e.g., AGPAT9 expression between MCF7 and MDA-MB-231 cells)

    • ANOVA with post-hoc tests for multiple group comparisons

    • Linear regression for examining relationships between AGPAT9 expression and continuous variables

    • Example: Analysis of V-ATPase activity showed significant differences between control and AGPAT9-overexpressing cells (p = 0.0351)

  • Non-parametric alternatives (when normality assumptions are violated):

    • Mann-Whitney U test (for two groups)

    • Kruskal-Wallis test with post-hoc comparisons (for multiple groups)

    • Spearman's rank correlation (for association studies)

For categorical analyses:

  • Chi-square or Fisher's exact test for association between AGPAT9 expression categories and clinical parameters

  • Logistic regression for predicting binary outcomes based on AGPAT9 expression

For survival analysis:

  • Kaplan-Meier curves with log-rank tests to compare survival between AGPAT9 expression groups

  • Cox proportional hazards models for multivariate analysis including AGPAT9 and other prognostic factors

For high-dimensional data:

  • Principal component analysis (PCA) or t-SNE for dimensionality reduction

  • Hierarchical clustering to identify patterns in gene expression datasets including AGPAT9

  • GSEA (Gene Set Enrichment Analysis) to identify pathways associated with AGPAT9 expression

Statistical considerations:

  • Sample size determination: Perform power analysis before beginning experiments

  • Multiple testing correction: Apply FDR (False Discovery Rate) or Bonferroni correction when performing multiple comparisons

  • Effect size reporting: Include measures of effect size (Cohen's d, fold change) alongside p-values

  • Data transformation: Consider log transformation for gene expression data that typically follows log-normal distribution

  • Outlier handling: Establish and document clear criteria for identifying and handling outliers

Reporting recommendations:

  • Clearly state statistical tests used with justification

  • Report exact p-values rather than ranges (p < 0.05)

  • Include 95% confidence intervals where appropriate

  • Provide complete descriptive statistics (mean, median, standard deviation)

  • Use appropriate graphical representations with error bars indicating variation

Following these statistical approaches will ensure robust and reproducible analysis of AGPAT9 expression data in cancer research .

How can I design experiments to investigate AGPAT9's role in lipid metabolism alterations in cancer?

Investigating AGPAT9's role in cancer-associated lipid metabolism requires specialized experimental designs that integrate enzymatic, analytical, and cellular approaches:

Enzymatic activity characterization:

  • Substrate specificity profiling:

    • Test AGPAT9 activity with various acyl-CoA donors (varying chain length and saturation)

    • Compare activity with different lysophospholipid acceptors

    • Determine kinetic parameters (Km, Vmax) under varying conditions

  • Activity modulation experiments:

    • Analyze effects of pH, temperature, and ionic conditions on AGPAT9 activity

    • Evaluate potential allosteric regulators and inhibitors

    • Compare enzymatic properties in normal vs. cancer-derived AGPAT9

Lipidomic approaches:

  • Global lipid profiling:

    • Use liquid chromatography-mass spectrometry (LC-MS/MS) to quantify lipidome changes

    • Compare lipid profiles between AGPAT9-overexpressing, knockdown, and control cells

    • Identify specific lipid species most affected by AGPAT9 modulation

  • Metabolic flux analysis:

    • Employ stable isotope labeling (e.g., 13C-labeled glycerol or fatty acids)

    • Track incorporation into various lipid species over time

    • Calculate synthesis and turnover rates of AGPAT9-dependent lipids

Membrane property assessments:

  • Biophysical characterization:

    • Measure membrane fluidity using fluorescence anisotropy

    • Assess membrane domain organization using super-resolution microscopy

    • Determine lipid raft composition in relation to AGPAT9 expression

  • Functional correlates:

    • Investigate membrane protein localization and activity

    • Examine effects on receptor signaling and endocytosis

    • Assess impact on drug permeability and resistance

Experimental design considerations:

  • Include appropriate controls for each experimental condition

  • Ensure metabolic steady-state where appropriate

  • Account for potential compensatory mechanisms by other lipid-metabolizing enzymes

  • Use multiple complementary techniques to validate findings

  • Consider both acute and chronic effects of AGPAT9 modulation

Integrated analysis approach:

  • Correlate lipid compositional changes with cancer-relevant phenotypes

  • Develop computational models of AGPAT9's impact on lipid metabolism

  • Identify potential intervention points in AGPAT9-dependent lipid pathways

By systematically applying these experimental approaches, researchers can elucidate how AGPAT9-mediated alterations in lipid metabolism contribute to cancer development, progression, and drug response . The findings may reveal novel lipid-based biomarkers or therapeutic targets in AGPAT9-expressing cancers.

How can AGPAT9 be leveraged as a potential therapeutic target in cancer?

The tumor-suppressive properties of AGPAT9 suggest several promising therapeutic strategies:

Expression restoration approaches:

  • Epigenetic modulation: If AGPAT9 downregulation involves epigenetic silencing, DNA methyltransferase inhibitors or HDAC inhibitors may restore expression.

  • Targeted gene therapy: Viral vector-mediated delivery of AGPAT9 to tumors could restore expression in deficient cells, as demonstrated in laboratory models .

  • Transcriptional activation: Small molecules that enhance AGPAT9 transcription could be identified through high-throughput screening approaches.

Pathway-based interventions:

  • KLF4 activation: Since AGPAT9 works partly through upregulating KLF4, compounds that activate KLF4 could mimic AGPAT9's effects .

  • LASS2 pathway targeting: Directly activating downstream effectors in the AGPAT9→KLF4→LASS2 pathway might bypass the need for AGPAT9 itself.

  • Combination with V-ATPase inhibitors: Since AGPAT9 inhibits V-ATPase activity, combining AGPAT9-based therapies with V-ATPase inhibitors could produce synergistic effects .

Chemosensitization strategies:

  • Adjuvant to conventional chemotherapy: Given AGPAT9's effect on doxorubicin sensitivity, combining AGPAT9 restoration with standard chemotherapy could enhance efficacy .

  • Overcoming drug resistance: In resistant tumors with low AGPAT9 expression, restoring AGPAT9 might re-establish drug sensitivity.

  • pH-gradient normalization: By modulating tumor acidification through V-ATPase inhibition, AGPAT9-based therapies could create a more favorable environment for weak-base chemotherapeutics.

Targeting considerations:

  • Tissue specificity: Design delivery systems that preferentially target tumor cells over normal tissues with high AGPAT9 expression.

  • Biomarker-based patient selection: Identify patients most likely to benefit based on baseline AGPAT9 expression and pathway activation status.

  • Resistance mechanisms: Anticipate and address potential compensatory mechanisms that might emerge during AGPAT9-targeted therapy.

The potential of AGPAT9 as a therapeutic target is supported by strong preclinical evidence, but several challenges remain in translating these findings to clinical applications . Addressing these challenges through systematic research could unlock the therapeutic potential of this promising target.

What techniques are available for monitoring AGPAT9 activity in living systems?

Monitoring AGPAT9 activity in living systems presents unique challenges that require specialized techniques beyond traditional biochemical assays:

Cellular activity probes:

  • Fluorescent substrate analogs:

    • Develop fluorescently labeled lysophospholipid substrates that change properties upon AGPAT9-mediated acylation

    • Design FRET-based reporters that respond to AGPAT9 activity

    • Utilize environment-sensitive fluorophores that detect AGPAT9-induced membrane changes

  • Genetically encoded biosensors:

    • Create fusion proteins that undergo conformational changes upon AGPAT9 substrate binding or product formation

    • Develop split fluorescent protein complementation systems activated by AGPAT9-dependent lipid production

    • Design AGPAT9 activity-dependent transcriptional reporters

Imaging approaches:

  • Mass spectrometry imaging (MSI):

    • Map spatial distribution of AGPAT9 substrates and products in tissues

    • Correlate with AGPAT9 expression patterns

    • Track changes in lipid composition following treatments

  • Metabolic labeling with imaging:

    • Use click chemistry-compatible lipid precursors for visualization

    • Apply CARS (Coherent Anti-Stokes Raman Scattering) microscopy for label-free lipid imaging

    • Employ time-lapse imaging to track dynamic changes in AGPAT9-dependent lipids

In vivo monitoring strategies:

  • Reporter models:

    • Generate transgenic models with AGPAT9 promoter-driven reporter genes

    • Develop conditional expression systems to study spatial and temporal regulation

    • Create knock-in models with tagged AGPAT9 for localization studies

  • Non-invasive approaches:

    • Apply magnetic resonance spectroscopy (MRS) to detect lipid composition changes

    • Develop PET tracers for AGPAT9 substrates or products

    • Use ultrasound with targeted contrast agents for AGPAT9-rich tissues

Technical considerations:

  • Validate all probes for specificity among related acyltransferases

  • Control for differences in probe uptake and distribution

  • Consider the impact of probes on normal AGPAT9 function

  • Account for compensatory mechanisms that maintain lipid homeostasis

  • Establish appropriate positive and negative controls

While many of these approaches remain in development, they represent promising directions for understanding AGPAT9 dynamics in living systems . As these methods mature, they will enable deeper insights into AGPAT9's physiological and pathological roles.

What are the most significant unresolved questions in AGPAT9 research?

Despite significant advances in understanding AGPAT9 biology, several critical questions remain unresolved:

  • Regulatory mechanisms: How is AGPAT9 expression and activity regulated under normal physiological conditions and in disease states? The dramatic differences in expression between drug-sensitive and resistant cell lines (240-fold) suggest powerful regulatory mechanisms that remain poorly characterized .

  • Tissue-specific functions: Given its differential expression across tissues, does AGPAT9 serve distinct functions in different cellular contexts? Research has focused primarily on breast cancer models, leaving its role in other tissues largely unexplored .

  • Substrate specificity in vivo: While AGPAT9's enzymatic function has been characterized biochemically, its actual substrate preferences in living cells under various conditions remain unclear.

  • Mechanistic links: How does AGPAT9, primarily characterized as a lipid-modifying enzyme, regulate transcription factors like KLF4? The signaling pathways connecting AGPAT9's enzymatic activity to gene expression changes need further elucidation .

  • Clinical relevance: Does AGPAT9 expression correlate with clinical outcomes in cancer patients? Larger cohort studies are needed to validate its potential as a prognostic or predictive biomarker.

  • Therapeutic targeting: Can AGPAT9 be effectively targeted for cancer therapy? Approaches for specifically modulating its expression or activity in cancer cells require development and validation.

  • Resistance mechanisms: How do cancer cells adapt to changes in AGPAT9 expression? Understanding compensatory pathways is essential for developing effective therapeutic strategies.

  • Microenvironmental interactions: How does AGPAT9-mediated regulation of tumor acidity impact immune cell function and the tumor microenvironment beyond cancer cell-autonomous effects?

Addressing these questions will require interdisciplinary approaches combining biochemistry, cell biology, genetics, and clinical research. The answers promise to advance both fundamental understanding of AGPAT9 biology and its potential applications in cancer diagnosis and treatment .

What standardized protocols should researchers follow when studying AGPAT9?

To ensure reproducibility and comparability across studies, researchers investigating AGPAT9 should adhere to the following standardized protocols:

Expression analysis standardization:

  • RNA quantification:

    • Use validated primer sets that specifically amplify AGPAT9 without cross-reactivity to related family members

    • Include multiple reference genes for normalization (e.g., GAPDH, β-actin, and a tissue-specific stable reference)

    • Report expression as fold change using the 2^(-ΔΔCt) method with appropriate statistical analysis

  • Protein detection:

    • Validate antibodies using positive and negative controls (overexpression and knockdown samples)

    • Document antibody sources, catalog numbers, and dilutions used

    • Include molecular weight markers and demonstrate expected band size (~60 kDa)

Functional assays standardization:

  • Enzymatic activity measurements:

    • Clearly describe reaction conditions (buffer composition, pH, temperature, substrate concentrations)

    • Include enzyme kinetics (Km, Vmax) where appropriate

    • Compare activity to recombinant standards when possible

  • Cell-based assays:

    • Document cell line sources, passage numbers, and authentication methods

    • Standardize cell density and culture conditions

    • Use multiple complementary assays for key phenotypes (e.g., at least two different methods for measuring proliferation)

Genetic manipulation protocols:

  • Overexpression systems:

    • Document vector details including promoter type and tag information

    • Verify expression levels by qRT-PCR and Western blot

    • Include appropriate vector-only controls

  • Knockdown/knockout approaches:

    • Provide complete sequence information for siRNA, shRNA, or CRISPR guide RNAs

    • Verify knockdown/knockout efficiency at both mRNA and protein levels

    • Include scrambled sequence controls and rescue experiments where feasible

Data reporting standards:

  • Statistical methods:

    • Clearly state all statistical tests used with justification

    • Report exact p-values rather than thresholds

    • Include information on sample size determination and any exclusion criteria

  • Experimental details:

    • Provide comprehensive methods allowing reproduction by other laboratories

    • Document reagent sources and catalog numbers

    • Share raw data in public repositories when possible

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.