Recombinant Human Glycerophosphodiester phosphodiesterase domain-containing protein 4 (GDPD4)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant GDPD4 exhibits enzymatic activity consistent with its biological role:

PropertyDetailsSource
EC Number3.1.-.- (ester bond cleavage)
Substrate SpecificityPredicted hydrolysis of glycerophosphodiester bonds (e.g., glycerophosphoinositol)
Metal Ion BindingPredicted metal ion-dependent catalytic activity

While direct experimental validation of substrate specificity for the recombinant protein is limited, its homology to GDPD1 (a confirmed glycerophosphodiesterase) suggests conserved enzymatic function .

Applications in Research and Biotechnology

Recombinant GDPD4 is utilized in:

ApplicationDetailsSource
SDS-PAGEPurity assessment and molecular weight verification
Western BlottingDetection of GDPD4 expression in lysates using tag-specific antibodies
ELISAQuantitative analysis of protein interactions or enzymatic activity
Enzyme StudiesIn vitro assays to characterize phosphodiesterase activity

Challenges and Future Directions

  1. Experimental Validation: Limited data on enzymatic activity or substrate specificity for recombinant GDPD4 necessitates further biochemical characterization.

  2. Therapeutic Potential: Its association with lipid metabolism disorders (e.g., Achromatopsia 4) suggests potential applications in drug discovery, pending functional validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GDPD4; GDE6; UGPQ; Glycerophosphodiester phosphodiesterase domain-containing protein 4; Glycerophosphodiester phosphodiesterase 6; UgpQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-623
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GDPD4
Target Protein Sequence
MLLFLWIETSSEYFNFDWVTFLGTGYWFFWSIFILSLARILTAYSSLLLLLGFLLLWERI ELYLHLCHKILILLVILLCVILMFIICKFWKERWLVAGLSMQIFAPYVHLVSITVMVILF WPVAFYVACLEREVRMRRYRMTHSEKKRLKQCNVITRLRGLQVPVGLPFLLILLGLYLMP LGIYSPCIQEKENLGPKPTIFGHRGAPMLGPENTMMSFEKAVEHGAHGLETDIHLSYDHV PFLMHDFDLKRTTNIGEVQPESACENPAFFNWDFLSTLNAGKWFVKPELRPFYNMKPLSE ADKERARNQSIPTLADLLTLAEKERKFVIFDLHRPPPKHPLRHTFVRQVVSVILASKIEQ HLIFWLPAHDRQYVRSVAPGFQHVGRLVSIETLAKNNISIINVDYKKLFPNGLRDYKAAN IHINVYTVNEPWLFSLAWCSRINSVTTDNIGLLSQLDHPHFFMTPKFYVFMWLLADIISV LFIVAIFCFHWRRETEKEKLFETSSTRTDTQSGNLHIAMKPPVRVVEGPWTLAALYPALP KSGKEHQGHFNFAAPSKKLLPIKNAVTPLKPGKHEIQPPMPTVVFELTQAPTRQATSEAT FQTTLPTLKVDKPTMPSIEVPYP
Uniprot No.

Target Background

Database Links

HGNC: 24849

KEGG: hsa:220032

STRING: 9606.ENSP00000320815

UniGene: Hs.249795

Protein Families
Glycerophosphoryl diester phosphodiesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and predicted function of human GDPD4?

GDPD4, also known as GDE6, is a glycerophosphodiester phosphodiesterase domain-containing protein predicted to catalyze the hydrolysis of glycerophosphodiesters. The protein is encoded by a gene located on chromosome 11q13.5 and contains 18 exons . The primary structure consists of a glycerophosphodiester phosphodiesterase domain that enables its enzymatic activity. GDPD4 is predicted to be membrane-associated, which is consistent with its proposed function in lipid metabolic processes . Researchers investigating this protein should consider its membrane localization when designing extraction and purification protocols, as detergents may be required to solubilize the protein effectively from its native environment.

How does GDPD4 expression vary across tissues and developmental stages?

GDPD4 demonstrates a notable tissue-specific expression pattern, being predominantly overexpressed in spermatocytes of mouse testis . This expression pattern suggests a specialized role in male germ cell differentiation . When designing experiments to study GDPD4, researchers should consider this tissue specificity. For developmental studies, tracking GDPD4 expression throughout spermatogenesis using techniques such as single-cell RNA sequencing, in situ hybridization, or immunohistochemistry with stage-specific markers would provide valuable insights. Unlike some other members of the GDPD family that show broader expression patterns, the restricted expression of GDPD4 suggests a specialized function in reproductive biology rather than a general housekeeping role.

What are the established differences between GDPD4 and other members of the GDPD family?

GDPD4 is one of several GDPD family members (GDPD1-5), each with distinct expression patterns and potential functions. Unlike GDPD5, which has been associated with breast cancer malignancy and choline phospholipid metabolism , GDPD4's role appears more specialized to reproductive tissues. GDPD1 (GDE4) has been detected in human ovary and small intestine, showing over 80% amino acid homology between humans and other mammals . GDPD2 (GDE3) is involved in differentiation, actin cytoskeleton modulation, and morphological changes of mouse osteoblasts . The role of GDPD3 remains largely unknown . When designing experiments to study GDPD specificity, researchers should carefully select primers that distinguish between these family members, as demonstrated in the literature with gene-specific primers designed using the Primer-BLAST tool .

What are the optimal expression systems for producing recombinant human GDPD4?

For producing recombinant human GDPD4, multiple expression systems have been successfully employed. According to available data, recombinant GDPD4 has been expressed in E. coli, yeast, baculovirus, and mammalian cell expression systems, with each offering different advantages . Cell-free expression systems have also proven effective for producing functional GDPD4 . When choosing an expression system, researchers should consider:

  • E. coli: Suitable for high-yield production but may lack post-translational modifications

  • Yeast: Offers eukaryotic processing with moderate yield

  • Baculovirus: Provides insect cell-based expression with proper folding and modifications

  • Mammalian cells: Best mimics native modifications but has lower yield

  • Cell-free expression: Rapid production without cellular constraints

The choice should depend on the specific research question, with mammalian systems preferred for functional studies requiring native-like post-translational modifications, while bacterial systems may be more suitable for structural studies requiring large quantities of protein.

What purification strategies yield the highest purity and activity for recombinant GDPD4?

Purification of recombinant GDPD4 to high purity levels (≥85% as determined by SDS-PAGE) has been achieved through multi-step chromatographic approaches . For optimal purification results, researchers should consider implementing:

  • Affinity chromatography: Using polyhistidine tags or other fusion tags for initial capture

  • Ion exchange chromatography: To separate based on charge differences

  • Size exclusion chromatography: As a polishing step to remove aggregates and degradation products

It's important to note that the membrane-associated nature of GDPD4 may necessitate the use of detergents during extraction and purification processes. The choice of detergent should be optimized to maintain protein activity while effectively solubilizing the protein from membranes. Activity assays should be performed at each purification step to ensure that the native conformation and catalytic activity are preserved throughout the purification process.

What are the established methods for measuring GDPD4 enzymatic activity?

While specific activity assays for GDPD4 are not extensively detailed in the provided search results, enzymatic activity of glycerophosphodiester phosphodiesterases can generally be measured by:

  • Monitoring the release of glycerol-3-phosphate using coupled enzymatic assays

  • Quantifying the release of corresponding alcohols from different glycerophosphodiester substrates

  • Using radiolabeled substrates to track reaction products

When establishing GDPD4 activity assays, researchers should consider that GDPD4 is predicted to enable glycerophosphodiester phosphodiesterase activity and is likely involved in lipid metabolic processes . The assay conditions should mimic the physiological environment of sperm cells where GDPD4 is predominantly expressed . Parameters such as pH, temperature, divalent cation concentrations, and substrate specificity should be systematically optimized to establish reliable activity measurements.

What is the current understanding of GDPD4's role in sperm development and function?

GDPD4 (GDE6) is predominantly overexpressed in spermatocytes of mouse testis, suggesting a role in male germ cell differentiation . Interestingly, studies examining GDPD4 mutant mice found that they remained fertile despite the mutations , indicating that GDPD4 might not be essential for fertility or that compensatory mechanisms exist. This contrasts with other reproductive tract-specific proteins whose disruption resulted in male sterility or severe fertility defects .

For researchers investigating GDPD4's role in reproduction, several approaches are recommended:

  • Detailed phenotypic analysis of sperm from GDPD4 knockout models beyond basic fertility assessment

  • Examination of potential compensatory upregulation of other GDPD family members in knockout models

  • Investigation of GDPD4's role under stress conditions or in combination with other genetic perturbations

  • Analysis of potential subtle defects in sperm membrane composition, motility parameters, or capacitation

The apparent redundancy in function suggests evolutionary importance that may be revealed under specific physiological challenges not evident in standard laboratory conditions.

How does GDPD4 contribute to membrane phospholipid metabolism?

As a member of the glycerophosphodiester phosphodiesterase family, GDPD4 is predicted to be involved in lipid metabolic processes and is likely active in membranes . GDPDs generally catalyze the hydrolysis of glycerophosphodiesters to produce glycerol-3-phosphate and the corresponding alcohol. In the context of sperm development and function, this enzymatic activity might be involved in:

  • Membrane remodeling during spermatogenesis

  • Maintenance of specific lipid compositions required for sperm function

  • Generation of signaling molecules derived from glycerophospholipid metabolism

  • Regulation of membrane fluidity and dynamics

Researchers studying GDPD4's role in phospholipid metabolism should consider employing lipidomic approaches to identify specific substrate preferences and membrane alterations in GDPD4-deficient models. Mass spectrometry-based methods would be particularly valuable for comprehensive characterization of lipid changes associated with GDPD4 activity or its absence.

What are the known interaction partners and regulatory mechanisms of GDPD4?

  • Membrane protein complexes involved in lipid metabolism

  • Potential interactions with cytoskeletal elements, particularly in the context of sperm development

  • Associations with signaling proteins regulated by or regulating phospholipid composition

Methodological approaches to identify interaction partners would include:

  • Immunoprecipitation followed by mass spectrometry

  • Proximity labeling techniques such as BioID or APEX

  • Yeast two-hybrid screening using the soluble domains of GDPD4

  • Membrane-based two-hybrid systems for full-length protein interaction studies

For regulatory mechanisms, researchers should investigate potential post-translational modifications, transcriptional regulation specific to spermatogenesis, and spatial regulation through membrane domain localization.

Is there evidence for GDPD4 involvement in human diseases or pathological conditions?

Researchers exploring disease associations should consider:

  • Analysis of GDPD4 expression in testicular cancer specimens compared to normal tissue

  • Examination of single nucleotide polymorphisms (SNPs) or mutations in the GDPD4 gene in patient cohorts with male infertility

  • Investigation of GDPD4 as a potential biomarker for specific types of male reproductive disorders

  • Evaluation of epigenetic regulation of GDPD4 in disease states

The ClinVar database contains reported variants for GDPD4 , which could serve as a starting point for investigating potential disease associations, although their clinical significance may not yet be established.

How does GDPD4 compare to GDPD5 in the context of cancer metabolism?

GDPD5 has been identified as a glycerophosphocholine phosphodiesterase (GPC-PDE) associated with breast cancer malignancy, particularly in estrogen receptor negative (ER−) cancers . GDPD5 expression positively correlates with phosphocholine (PC), total choline, and PC/GPC ratios in human breast tumors . In contrast, there is currently no established connection between GDPD4 and cancer metabolism in the provided search results.

For researchers interested in comparing GDPD4 and GDPD5 in cancer contexts:

  • Expression analysis of both proteins across cancer types, with particular attention to reproductive system cancers for GDPD4

  • Functional studies to determine if GDPD4, like GDPD5, possesses GPC-PDE activity

  • Metabolomic profiling to identify specific substrates and products for each enzyme

  • Investigation of potential compensatory mechanisms between family members when one is dysregulated

The methodological approach used to study GDPD5 in breast cancer, combining magnetic resonance spectroscopy (MRS) with qRT-PCR , provides a valuable template for similar studies of GDPD4 in appropriate tissue contexts.

What is known about GDPD4 genetic variants and their potential functional consequences?

For researchers investigating GDPD4 genetic variants:

  • The Variation Viewer for GDPD4 variants (mentioned in search result ) would be a valuable resource

  • Functional studies of identified variants could assess their impact on:

    • Protein stability and expression

    • Enzymatic activity

    • Cellular localization

    • Interaction with binding partners

  • Population genetics approaches could determine variant frequencies across different ethnic groups

  • Association studies might reveal connections between specific variants and reproductive parameters

When conducting such research, it would be important to use appropriate model systems that reflect the tissue-specific expression of GDPD4, such as spermatocyte cell lines or organoid cultures.

What structural biology approaches would be most effective for determining GDPD4's catalytic mechanism?

For elucidating GDPD4's structural features and catalytic mechanism, researchers should consider multiple complementary approaches:

  • X-ray crystallography: This would provide high-resolution structural information, particularly if GDPD4 can be crystallized in complex with substrates, products, or inhibitors. Researchers should focus on:

    • Expression and purification of large quantities of stable, homogeneous protein

    • Screening of crystallization conditions, potentially using lipid cubic phase methods for this membrane-associated protein

    • Co-crystallization with substrate analogs or product mimics

  • Cryo-electron microscopy (cryo-EM): Particularly valuable if GDPD4 forms larger complexes or if crystallization proves challenging

    • Single-particle analysis for solubilized protein

    • Tomography for membrane-embedded contexts

  • NMR spectroscopy: Useful for studying dynamics and smaller domains of GDPD4

    • Solution NMR for soluble domains

    • Solid-state NMR for membrane-associated states

  • Computational approaches:

    • Homology modeling based on structures of related GDPD family members

    • Molecular dynamics simulations to predict substrate binding and catalytic mechanisms

    • Quantum mechanics/molecular mechanics (QM/MM) studies for reaction mechanism details

The membrane association of GDPD4 presents particular challenges that might require specialized approaches like lipid nanodiscs or detergent micelles to maintain protein stability while enabling structural studies.

What systems biology approaches could reveal GDPD4's role in broader metabolic networks?

To place GDPD4 in the context of broader metabolic networks, particularly in spermatogenesis where it is predominantly expressed , researchers should consider integrative systems biology approaches:

  • Multi-omics integration:

    • Transcriptomics: RNA-seq of normal vs. GDPD4-deficient spermatocytes

    • Proteomics: Identification of altered protein expression and post-translational modifications

    • Metabolomics: Focused on phospholipid metabolism and glycerophosphodiester levels

    • Lipidomics: Detailed characterization of membrane lipid compositions

  • Network analysis:

    • Construction of gene co-expression networks to identify functional modules containing GDPD4

    • Metabolic flux analysis using isotope labeling to trace phospholipid metabolism

    • Protein-protein interaction networks to position GDPD4 within cellular signaling pathways

  • Computational modeling:

    • Constraint-based modeling of spermatocyte metabolism including GDPD4 reactions

    • Dynamic modeling of phospholipid metabolism during spermatogenesis

    • Integration of spatial information for membrane-associated processes

  • Single-cell approaches:

    • Single-cell transcriptomics to identify cell populations expressing GDPD4

    • Spatial transcriptomics to map GDPD4 expression within testicular architecture

    • Multi-parameter imaging to correlate GDPD4 with other markers during spermatogenesis

These approaches would help contextualize GDPD4's function within the complex cellular processes of spermatogenesis and potentially reveal unexpected connections to other metabolic pathways.

What are the most promising techniques for studying GDPD4 in the context of sperm membrane dynamics?

Given GDPD4's predominant expression in spermatocytes and predicted membrane association , specialized techniques for studying membrane dynamics would be particularly valuable:

  • Advanced microscopy approaches:

    • Super-resolution microscopy (STORM, PALM, STED) to visualize GDPD4 localization relative to membrane microdomains

    • Single-particle tracking to monitor GDPD4 dynamics in living sperm cells

    • FRET-based sensors to detect GDPD4 activity in real-time

    • Correlative light and electron microscopy to link function with ultrastructure

  • Membrane biophysics:

    • Atomic force microscopy to measure mechanical properties of membranes with and without GDPD4

    • Fluorescence recovery after photobleaching (FRAP) to assess membrane fluidity changes

    • Laurdan generalized polarization to measure membrane order in GDPD4-rich domains

  • Lipid biochemistry:

    • Targeted lipidomics focusing on glycerophosphodiesters and related metabolites

    • Activity assays in reconstituted membrane systems with defined lipid compositions

    • Enzymatic assays using native sperm membrane preparations as substrates

  • Genetic approaches:

    • CRISPR-Cas9 genome editing to create fluorescently tagged endogenous GDPD4

    • Conditional knockout models for stage-specific ablation during spermatogenesis

    • Transgenic reporter systems to monitor GDPD4 expression during sperm development and maturation

These methodologies would help elucidate how GDPD4 contributes to the unique membrane composition and dynamics required for proper sperm function, potentially revealing mechanistic insights into male fertility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.