Recombinant Human Glycerophosphodiester phosphodiesterase domain-containing protein 5 (GDPD5)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

GDPD5, also known as GDE2, belongs to a family of proteins containing the glycerophosphodiester phosphodiesterase motif (Pfam accession no. PF03009), which was initially identified in bacterial genes . The human GDPD5 protein is encoded by the GDPD5 gene (Entrez Gene ID: 81544) and is recognized in the UniProt database with the identifier Q8WTR4 . Several aliases are associated with this protein, including Glycerophosphocholine phosphodiesterase GDPD5, Glycerophosphodiester phosphodiesterase 2, and Phosphoinositide phospholipase C GDPD5 .

Evolutionary Context

The glycerophosphodiester phosphodiesterase motif was first characterized in bacterial genes, specifically GlpQ and UgpQ in Escherichia coli, which hydrolyze deacylated phospholipid glycerophosphodiesters . In yeast, the homologous protein Gde1p functions as a glycerophosphocholine phosphodiesterase (GPC-PDE) involved in retrieving choline from glycerophosphocholine (GPC) for the Kennedy pathway . The identification of mammalian glycerophosphodiester phosphodiesterases, including GDPD5, has revealed their conservation and functional importance across species.

Protein Structure

GDPD5 is a serpentine membrane protein containing seven putative transmembrane domains, consistent with its membrane localization . The protein demonstrates significant conservation across mammalian species, with human GDPD5 showing 93% sequence identity with both mouse and rat orthologs . This high degree of conservation suggests evolutionary importance and preserved functionality.

Table 1: Key Properties of Human GDPD5

PropertyDescriptionSource
Molecular IdentityGlycerophosphodiester phosphodiesterase domain-containing protein 5
Alternative NamesGDE2, Glycerophosphodiester phosphodiesterase 2
Gene AliasesGDE2, GDPD5, PP1665, PP6037, PP9363, UNQ1850/PRO3580
Structural FeaturesSeven transmembrane domains
Sequence Homology93% identity with mouse and rat orthologs
Subcellular LocalizationPerinuclear region, likely endoplasmic reticulum

Subcellular Localization

Recombinant GDPD5 localizes to the perinuclear region when transfected into various cell types, including HEK293 cells and COS7 cells . This localization pattern is consistent with endoplasmic reticulum (ER) residency. Importantly, GDPD5 colocalizes with neuropathy target esterase (NTE), a known ER protein involved in glycerophosphocholine synthesis from phosphatidylcholine . This colocalization suggests a potential functional relationship between these enzymes in phospholipid metabolism, although direct protein-protein interaction through co-immunoprecipitation has not been observed .

Enzymatic Activity

GDPD5 functions as a glycerophosphocholine phosphodiesterase (GPC-PDE), hydrolyzing glycerophosphocholine into choline and α-glycerophosphate . This enzymatic activity has been directly demonstrated through immunoprecipitation of recombinant GDPD5-V5 from transfected HEK293 cells, with the immunoprecipitate exhibiting significant GPC-PDE activity in vitro . Overexpression of recombinant GDPD5 in cells increases GPC-PDE activity and decreases cellular GPC levels, while siRNA knockdown of GDPD5 increases GPC concentration .

Regulation by Osmotic Stress

GDPD5 activity is subject to osmotic regulation, which is particularly significant in the renal medulla where cells are exposed to high osmolality. When the osmolality bathing cells is elevated by adding NaCl or urea, GDPD5's GPC-PDE activity is rapidly inhibited, beginning within one hour of exposure . This inhibition leads to increased cellular GPC levels, which serve as osmoprotective organic osmolytes .

Table 2: Regulation of GDPD5 Under Osmotic Stress

ConditionEffect on GDPD5 ActivityEffect on GDPD5 mRNAEffect on Cellular GPC
High NaCl (500 mosmol/kg)Inhibition within 1 hourDecreased abundance via increased degradation rateIncreased
High UreaInhibition within 1 hourNo significant changeIncreased
Combined NaCl and UreaInhibitionDecreased abundanceSignificantly increased

Phospholipid Metabolism

GDPD5 plays a crucial role in phospholipid metabolism, particularly in the processing of glycerophosphocholine (GPC) . GPC is synthesized from phosphatidylcholine by neuropathy target esterase (NTE) and subsequently broken down by GDPD5 . This metabolic pathway contributes to phosphatidylcholine homeostasis, which is essential for membrane integrity and function . In yeast, the cooperation between NTE and GPC-PDE homologs is important for phosphatidylcholine recycling, and a similar role is proposed for GDPD5 in mammalian cells .

Neuronal Development and Differentiation

GDPD5 is necessary for spinal motor neuron differentiation and retinoid-induced neuronal outgrowth . It is expressed in neurons, terminally differentiated oligodendrocyte subsets, and vascular endothelium . In neuroblastoma, GDPD5 promotes differentiation by releasing glypican, suggesting its involvement in neuronal cell fate determination . These findings underscore GDPD5's importance in neuronal development and potential implications for neurodevelopmental disorders.

Osmoregulation

In the renal medulla, where cells are exposed to varying osmotic conditions, GDPD5 contributes to the regulation of cellular GPC levels . Under high osmolality conditions created by NaCl or urea, inhibition of GDPD5 activity leads to accumulation of GPC, which serves as an organic osmolyte protecting cells against osmotic stress . GDPD5 acts synergistically with NTE to adapt cells to osmotic stress in the renal medulla, where high NaCl and urea concentrations are physiologically normal .

Cancer Biology

Altered choline phospholipid metabolism is a hallmark of cancer, and GDPD5 has been implicated in this metabolic reprogramming . Elevated expression of GDPD5 correlates with malignant choline phospholipid metabolite profiles in human breast cancer . Conversely, in neuroblastoma, GDPD5 appears to inhibit cell proliferation and migration of SH-SY5Y cells, suggesting a cancer type-specific role .

Prognostic Significance in Neuroblastoma

Recent research has identified GDPD5 as a potential prognostic biomarker in neuroblastoma . A study analyzing lipid-metabolism-related genes in neuroblastoma identified GDPD5 as part of a three-gene prognostic model that effectively predicts patient outcomes . Kaplan-Meier analysis demonstrated a significant association between GDPD5 expression and survival in neuroblastoma patients .

Table 3: GDPD5 in Cancer Research

Cancer TypeObservationPotential SignificanceSource
Breast CancerElevated GDPD5 expression correlates with malignant choline phospholipid profilesPotential biomarker or therapeutic target
NeuroblastomaGDPD5 inhibits SH-SY5Y cell proliferation and migrationPrognostic biomarker; potential tumor suppressor
NeuroblastomaPart of three-gene prognostic model with ACHE and PIK3R1Prediction of patient outcomes
NeuroblastomaAssociated with immune infiltrationPotential implications for immunotherapy approaches

Immune System Interactions

In neuroblastoma, GDPD5 expression has been associated with immune infiltration . Gene Set Enrichment Analysis (GSEA) revealed that samples with high GDPD5 expression were enriched for specific KEGG pathways and oncology signatures . Additionally, GDPD5 expression showed relationships with stromal, immune, and estimate scores, suggesting a connection between GDPD5 and the tumor microenvironment . This association could have implications for immunotherapy approaches in cancer treatment.

Research Applications

Recombinant GDPD5 has numerous applications in biomedical research. The control fragment (aa 517-585) from Thermo Fisher is specifically designed for blocking experiments with the corresponding antibody (PA5-64287) . For such applications, a 100x molar excess of the protein fragment control is recommended, pre-incubated with the antibody for 30 minutes at room temperature . Beyond antibody validation, recombinant GDPD5 is valuable for studying the protein's enzymatic activity, its role in lipid metabolism, neuronal differentiation, and its potential as a biomarker in various diseases.

Therapeutic Potential

Given GDPD5's involvement in neuronal differentiation and its potential tumor-suppressive role in neuroblastoma, further investigation into its therapeutic applications is warranted. Strategies to modulate GDPD5 expression or activity could potentially promote neuronal differentiation in neurodevelopmental disorders or inhibit tumor growth in specific cancers. Additionally, the relationship between GDPD5 and immune infiltration in tumors suggests potential implications for immunotherapy approaches.

Expanded Biomarker Applications

The identification of GDPD5 as part of a prognostic model in neuroblastoma opens avenues for exploring its biomarker potential in other cancers and diseases. Further research could validate its utility in larger patient cohorts and different cancer types, potentially leading to improved diagnostic and prognostic tools. Additionally, the association of GDPD5 with altered choline phospholipid metabolism in breast cancer suggests broader applications in cancer metabolomics.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for the specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
GDPD5; GDE2; PP6037; PP9363; UNQ1850/PRO3580; Glycerophosphodiester phosphodiesterase domain-containing protein 5; Glycerophosphocholine phosphodiesterase GDPD5; Glycerophosphodiester phosphodiesterase 2; Phosphoinositide phospholipase C GDPD5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-605
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GDPD5
Target Protein Sequence
MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLY FWWEVHNDYDEFNWYLYNRMGYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNL HWLHKIGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHVGAVAAVTMLSWIVA GQFARAERTSSQVTILCTFFTVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLA PEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEEEFPELARRPASML NWTTLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAKGNATLLLNLR DPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPLVRKVAPGFQQTSGSKEAVAS LRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHA LSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVR RTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLI ERSGR
Uniprot No.

Target Background

Function
Glycerophosphodiester phosphodiesterase promotes neurite formation and drives spinal motor neuron differentiation. It mediates the cleavage of glycosylphosphatidylinositol (GPI) anchor of target proteins, specifically removing the GPI-anchor of RECK, leading to RECK release from the plasma membrane. This enzyme may contribute to the osmotic regulation of cellular glycerophosphocholine.
Gene References Into Functions
  1. Data suggest that GDE2/gdpd5 play crucial roles in pancreatic organogenesis. Knockdown of gdpd5 in zebrafish embryos leads to differentiation defects in the pancreas. Studies using recombinant fusion proteins suggest similar roles for homologous human GDE2 and zebrafish gdpd5. PMID: 29203233
  2. miR-195-5p acts as a potent suppressor of GDPD5, significantly increasing chemosensitivity and apoptosis in chemoresistant colorectal cells. PMID: 29635904
  3. GDPD5 expression is strongly associated with favorable outcomes in neuroblastoma. GDE2 induces differentiation of neuroblastoma cells, suppresses cell motility, and counteracts RhoA-driven neurite retraction. PMID: 27693046
  4. GDPD5 has been identified as a glycerophosphocholine phosphodiesterase that likely participates in the regulation of choline phospholipid metabolism in breast cancer. PMID: 22279038
  5. GDPD5 was widely expressed in human tissues, with relatively low expression levels observed in kidney and prostate. PMID: 17578682

Show More

Hide All

Database Links

HGNC: 28804

OMIM: 609632

KEGG: hsa:81544

STRING: 9606.ENSP00000337972

UniGene: Hs.503297

Protein Families
Glycerophosphoryl diester phosphodiesterase family
Subcellular Location
Endomembrane system; Multi-pass membrane protein. Cytoplasm, perinuclear region. Cell projection, growth cone.

Q&A

What is GDPD5 and what are its primary functions in human physiology?

GDPD5 (glycerophosphodiester phosphodiesterase domain containing 5), also known as GDE2 or PP1665, is a protein-coding gene that enables glycerophosphodiester phosphodiesterase activity. Its primary biochemical function is hydrolyzing glycerophosphocholine (GPC) into choline and glycerol 3-phosphate, playing a crucial role in phospholipid metabolism .

GDPD5 has multiple physiological functions, including:

  • Negative regulation of Notch signaling pathway

  • Positive regulation of cell cycle progression

  • Positive regulation of neuron differentiation

  • Regulation of timing of cell differentiation

In cellular contexts, GDPD5 is critical for neuronal differentiation, growth, and survival. It has been demonstrated to promote neuroblastoma (NB) differentiation through the release of glypican . Additionally, GDPD5 contributes significantly to osmotic regulation of cells by modulating GPC levels, which serves as an osmoprotective organic osmolyte .

What is the genomic context and structure of the GDPD5 gene?

The GDPD5 gene has the following genomic characteristics:

  • Chromosomal Location: 11q13.4-q13.5

  • Precise Sequence Location: Chromosome 11; NC_000011.10 (75434640..75525941, complement)

  • Exon Structure: Contains 29 exons

  • Gene Type: Protein coding

Researchers studying GDPD5 should note that variations in this gene can be explored through several resources:

  • ClinVar for variants reported in clinical contexts

  • dbVar for studies and structural variants

  • SNP Variation Viewer for GDPD5 variants

  • Genome viewer for exploring NCBI-annotated assemblies

What is the subcellular localization of GDPD5 protein?

GDPD5 exhibits specific subcellular localization patterns that are important for its function:

  • Neuronal Structures: Present in axons and neuronal cell bodies

  • Endoplasmic Reticulum: Specifically localized to the perinuclear endoplasmic reticulum

  • Plasma Membrane: Functionally active at the plasma membrane

Recombinant GDPD5 has been observed to colocalize with neuropathy target esterase in the perinuclear region of HEK293 cells, suggesting important functional interactions in this cellular compartment . In expression studies, researchers should consider these localization patterns when designing constructs and selecting cellular models.

What are the most effective methods for measuring GDPD5 enzymatic activity?

Measurement of GDPD5's glycerophosphocholine phosphodiesterase activity can be performed through several validated approaches:

In vitro Enzymatic Assay:

  • Immunoprecipitate recombinant GDPD5 from transfected cells

  • Incubate the immunoprecipitated protein with GPC substrate

  • Measure the degradation of GPC and/or formation of choline and glycerol 3-phosphate

Cellular Activity Assessment:

  • Modulate GDPD5 expression (via overexpression or knockdown)

  • Measure cellular GPC-PDE activity

  • Correlate with changes in GPC levels

For studying osmotic regulation effects on GDPD5 activity:

  • Compare enzyme activity in cell extracts from cells exposed to normal osmolality (300 mosmol/kg) versus high osmolality (500 mosmol/kg by adding NaCl or urea)

  • Assess changes in substrate degradation rates under these different conditions

What gene manipulation techniques are most suitable for GDPD5 functional studies?

Several effective techniques have been validated for GDPD5 manipulation in experimental models:

siRNA Knockdown:

  • Successfully employed in mouse inner medullary collecting duct-3 (mIMCD-3) cells

  • Results in measurable increases in cellular GPC levels at normal osmolality (300 mosmol/kg)

  • Provides insights into the physiological role of GDPD5 in GPC metabolism

Tissue-Specific Knockout Models:

  • Skeletal muscle-specific knockout (Gde5 skKO) has been generated

  • Allows for assessment of tissue-specific functions while avoiding embryonic lethality observed in homozygous whole-body knockouts

  • Enables in vivo functional studies, including contractile properties assessment

Heterozygous Knockout Models:

  • Viable option when homozygous knockout causes embryonic lethality

  • Shows significant GPC accumulation across tissues

  • Allows for studying partial loss of function

Recombinant Protein Expression:

  • Overexpression in cell culture models increases cellular GPC-PDE activity

  • Results in decreased GPC levels

  • Useful for structure-function analyses and biochemical characterization

How can researchers effectively study GDPD5's role in osmotic regulation?

To investigate GDPD5's involvement in osmotic regulation:

Cell Culture Osmotic Challenge Protocol:

  • Culture cells (e.g., mIMCD-3) at normal osmolality (300 mosmol/kg)

  • Expose cells to elevated osmolality (500 mosmol/kg) by adding NaCl or urea

  • Measure changes in:

    • GDPD5 enzymatic activity using immunoprecipitated protein

    • GDPD5 mRNA abundance via qPCR

    • GDPD5 protein levels via Western blotting

    • Cellular GPC levels

Key Experimental Considerations:

  • High NaCl not only inhibits GDPD5 activity but also decreases its mRNA abundance by increasing degradation rate

  • High urea inhibits activity without affecting mRNA levels

  • Both mechanisms contribute to GPC accumulation under hyperosmotic conditions

This dual approach allows researchers to distinguish between transcriptional, post-transcriptional, and post-translational regulatory mechanisms affecting GDPD5 function during osmotic stress.

How does GDPD5 contribute to neuronal differentiation mechanisms?

GDPD5 plays a crucial role in neuronal differentiation through several mechanisms:

Regulation of Notch Signaling:

  • GDPD5 negatively regulates the Notch signaling pathway

  • This inhibition is essential for promoting neuronal differentiation

  • The precise molecular interaction with Notch pathway components requires further investigation

Glypican Release Mechanism:

  • GDPD5 has been shown to promote neuroblastoma differentiation specifically through the release of glypican

  • This mechanism suggests GDPD5 influences cell surface proteoglycan dynamics that control neuronal differentiation signaling

Research Methodology Recommendations:

  • Use neuronal cell line models (e.g., SH-SY5Y) with GDPD5 overexpression or knockdown

  • Assess differentiation markers (neurite outgrowth, expression of neuronal markers)

  • Analyze Notch pathway activation status (Hes1, Hey1 expression)

  • Measure glypican release in conditioned media

  • Perform rescue experiments with exogenous glypican addition

What is the significance of GDPD5 in phospholipid metabolism and muscle function?

GDPD5 (also referred to as GDE5/Gpcpd1) plays a critical role in phosphatidylcholine (PC) metabolism and muscle physiology:

Effects on Phospholipid Composition:

  • GDE5 deficiency alters glycerophospholipid profiles in skeletal muscle

  • Specifically reduces levels of phospholipids containing polyunsaturated fatty acids (PUFAs), such as docosahexaenoic acid (DHA)

  • These compositional changes resemble those observed in denervated muscles and Duchenne muscular dystrophy models

Impact on Muscle Function:

  • Skeletal muscle-specific GDE5 deletion (Gde5 skKO) results in:

    • Reduced passive force generation

    • Improved fatigue resistance in electrically stimulated gastrocnemius muscles

    • Higher glycolytic metabolites and glycogen levels

    • Altered ryanodine receptor function (increased opening probability)

    • Lower maximum Ca²⁺-activated force

Dietary Intervention Effects:

  • DHA-rich diet in GDE5-deficient models:

    • Enhances contractile force

    • Lowers fatigue resistance

    • Suggests functional relationship between PC fatty acid composition and muscle function

This research area highlights the importance of GDPD5 in maintaining proper membrane phospholipid composition, which directly impacts muscle contractility and metabolism.

What is the potential role of GDPD5 as a prognostic biomarker in neuroblastoma?

Recent research has identified GDPD5 as a potentially valuable prognostic marker in neuroblastoma (NB):

Lipid Metabolism-Related Gene Expression Profile:

  • GDPD5 is part of a three-gene trait model that can predict NB survival

  • Analysis of the Gene Expression Omnibus (GEO) database (GSE49710 dataset) showed differential expression of GDPD5 between high-risk and non-high-risk NB

Functional Significance in NB Cells:

  • GDPD5 inhibits proliferation and migration of SH-SY5Y neuroblastoma cells

  • This suggests tumor-suppressive properties that may explain its prognostic value

miRNA Regulation Mechanism:

  • hsa-miR-592 has been identified as a potential target miRNA of GDPD5

  • Kaplan-Meier analysis showed that hsa-miR-592 could effectively distinguish high-risk and low-risk NB groups

Recommended Research Approach:

  • Analyze GDPD5 expression in patient cohorts with known outcomes

  • Correlate expression levels with standard prognostic factors

  • Perform functional studies in NB cell lines with GDPD5 modulation

  • Investigate the GDPD5-miR-592 regulatory axis

  • Explore combination with other markers for improved prognostic value

How is GDPD5 expression and activity regulated at the transcriptional and post-translational levels?

GDPD5 regulation occurs through multiple mechanisms:

Transcriptional Regulation:

  • High NaCl exposure decreases GDPD5 mRNA abundance

  • This occurs through an increase in mRNA degradation rate rather than decreased transcription

  • In contrast, high urea does not affect GDPD5 mRNA levels

Post-Translational Regulation:

  • Both high NaCl and high urea rapidly inhibit GDPD5 enzymatic activity

  • This inhibition is observable in immunoprecipitated recombinant GDPD5 from exposed cells

  • The mechanism appears to involve conformational changes or modifications to the protein itself

miRNA Regulation:

  • Computational prediction using miRSystem identified potential GDPD5-targeted miRNAs

  • Analysis of differentially expressed miRNAs in high-risk versus non-high-risk neuroblastoma patients identified upregulated hsa-miR-107 and hsa-miR-592 as potential regulators

  • Downregulated hsa-miR-604 and hsa-miR-636 were ruled out as GDPD5 targets because GDPD5 is downregulated in high-risk patients, and miRNAs generally show inverse expression patterns with their targets

What technical challenges should researchers anticipate when working with recombinant GDPD5?

Researchers working with recombinant GDPD5 should be aware of several technical considerations:

Expression System Selection:

  • HEK293 cells have been successfully used for recombinant GDPD5 expression

  • The protein colocalizes with neuropathy target esterase in the perinuclear region, suggesting proper folding and targeting

Activity Assessment Challenges:

  • GDPD5 activity can be affected by cellular osmotic conditions

  • Researchers should standardize osmolality during protein expression and purification

  • Activity assays should account for potential inhibition by buffer components

Knockout Model Considerations:

  • Homozygous whole-body knockout results in embryonic lethality, necessitating alternative approaches:

    • Heterozygous models (show significant GPC accumulation)

    • Tissue-specific knockout (e.g., skeletal muscle-specific Gde5 skKO)

    • Conditional knockout systems

Protein Purification Recommendations:

  • Immunoprecipitation has been successful for isolating functional GDPD5

  • Activity can be measured using in vitro GPC degradation assays

  • Maintain consistent osmotic conditions throughout purification process

What are the latest findings regarding GDPD5's role in embryonic development?

While the search results provide limited direct information on GDPD5's role in embryonic development, several important observations can guide researchers:

Embryonic Lethality in Knockout Models:

  • Homozygous whole-body GDPD5/GDE5 knockout results in embryonic lethality

  • This indicates an essential role for GDPD5 in embryonic development that cannot be compensated by other mechanisms

Zebrafish Ortholog Functions:

  • The zebrafish ortholog gdpd5b acts upstream of or within axis elongation

  • This suggests evolutionary conservation of GDPD5's role in developmental patterning

  • The protein is located in the plasma membrane, similar to its mammalian counterpart

Research Direction Recommendations:

  • Use embryonic stem cell models with GDPD5 manipulation to study early developmental effects

  • Employ conditional knockout approaches to determine stage-specific requirements

  • Investigate GDPD5's interaction with developmental signaling pathways, particularly Notch

  • Utilize zebrafish gdpd5b as a model system for studying conserved developmental functions

How might GDPD5 function be exploited in therapeutic strategies for neurodegenerative diseases?

Given GDPD5's role in neuronal differentiation and membrane lipid metabolism, several therapeutic avenues warrant investigation:

Potential Therapeutic Applications:

  • Promoting neuronal differentiation in neurodegenerative contexts

  • Modulating membrane phospholipid composition to enhance neuronal function

  • Targeting the Notch signaling pathway through GDPD5-mediated mechanisms

Research Strategy Recommendations:

  • Screen for small molecule modulators of GDPD5 activity

  • Investigate GDPD5 expression patterns in neurodegenerative disease models and patient samples

  • Test GDPD5 overexpression effects in neuronal cultures derived from disease models

  • Explore combination approaches targeting both GDPD5 and downstream effectors

What methodologies are most effective for studying the relationship between GDPD5 and miRNAs?

To investigate GDPD5-miRNA interactions:

Computational Prediction Approach:

  • Use miRSystem or similar tools to predict GDPD5-targeted miRNAs

  • Cross-reference with differential expression data from relevant disease contexts

  • Prioritize candidates showing inverse expression patterns with GDPD5

Experimental Validation Protocol:

  • Perform luciferase reporter assays with GDPD5 3'-UTR and candidate miRNAs

  • Conduct miRNA mimic/inhibitor transfections and measure effects on GDPD5 expression

  • Analyze GDPD5 protein levels after miRNA manipulation

  • Investigate functional consequences of disrupting specific miRNA-GDPD5 interactions

Clinical Correlation Analysis:

  • Measure both GDPD5 and candidate miRNA levels in patient samples

  • Perform Kaplan-Meier survival analysis based on expression patterns

  • Evaluate potential as combined prognostic markers

What is the relationship between GDPD5 and mitochondrial function in metabolic disorders?

While direct evidence from the search results is limited, GDPD5's role in lipid metabolism suggests potential connections to mitochondrial function:

Research Questions to Explore:

  • Does GDPD5 deficiency affect mitochondrial membrane composition?

  • How do changes in glycerophospholipid profiles impact oxidative phosphorylation efficiency?

  • Is there cross-talk between GPC metabolism and mitochondrial bioenergetics?

Experimental Approach Recommendations:

  • Assess mitochondrial function parameters in GDPD5-deficient models:

    • Oxygen consumption rate

    • ATP production

    • Membrane potential

    • Reactive oxygen species generation

  • Analyze mitochondrial membrane phospholipid composition

  • Investigate potential interactions between GDPD5 and mitochondrial proteins

  • Explore GDPD5 expression in metabolic disease models characterized by mitochondrial dysfunction

Expression and Localization Data for GDPD5

Tissue/Cell TypeExpression LevelSubcellular LocalizationReference
NeuronsHighAxon, neuronal cell body, plasma membrane
OligodendrocytesSubset-specificNot specified
Vascular endotheliumPresentNot specified
Renal medullaPresentPerinuclear endoplasmic reticulum
Skeletal musclePresentPlasma membrane

Effects of Osmotic Challenges on GDPD5

ConditionEffect on ActivityEffect on mRNAMechanismPhysiological OutcomeReference
Normal osmolality (300 mosmol/kg)Baseline activityNormal expression-Normal GPC turnover
High NaCl (500 mosmol/kg)Rapid inhibitionDecreased abundanceIncreased mRNA degradationGPC accumulation
High urea (500 mosmol/kg)Rapid inhibitionNo changePost-translationalGPC accumulation

Physiological Effects of GDPD5/GDE5 Deficiency in Skeletal Muscle

ParameterEffect in GDE5-deficient musclePotential MechanismReference
Passive forceReducedAltered membrane composition
Fatigue resistanceImprovedHigher glycolytic metabolites and glycogen
Glycogen levelsIncreasedMetabolic reprogramming
Phospholipids with PUFAsReducedAltered PC metabolism
Ryanodine receptor functionIncreased opening probabilityMembrane composition changes
Maximum Ca²⁺-activated forceLoweredAltered contractile apparatus function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.