Recombinant Human Glycerophosphoinositol inositolphosphodiesterase GDPD2 (GDPD2)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification of GDPD2

GDPD2, formally known as glycerophosphodiester phosphodiesterase domain containing 2, is encoded by the GDPD2 gene located on chromosome Xq13.1 in humans . The protein is also known by alternative names including OBDPF (osteoblast differentiation promoting factor) and GDE3 (glycerophosphodiester phosphodiesterase 3), reflecting its diverse biological functions . The NCBI Gene ID for GDPD2 is 54857, establishing its unique identification in genomic databases .

Human GDPD2 belongs to the glycerophosphodiester phosphodiesterase enzyme family, a group of proteins that catalyze the hydrolysis of glycerophosphodiesters. This enzyme specifically hydrolyzes glycerophosphoinositol to produce inositol 1-phosphate and glycerol, making it a key player in phospholipid metabolism .

The following table summarizes the key molecular characteristics of GDPD2:

CharacteristicDescription
Full NameGlycerophosphoinositol inositolphosphodiesterase GDPD2
Gene SymbolGDPD2
SynonymsOBDPF, GDE3
NCBI Gene ID54857
Chromosome LocationXq13.1
Protein Length539 amino acids
Molecular Mass88.1 kDa (GST-tagged)
Source for Recombinant ProductionWheat Germ, Cell-free protein synthesis
Tag OptionsGST-tag (N-terminal), Strep-tag

Biochemical Function and Enzymatic Activity

GDPD2 exhibits highly specific glycerophosphoinositol inositolphosphodiesterase activity, demonstrating substrate selectivity that distinguishes it from other phosphodiesterases. The enzyme specifically hydrolyzes glycerophosphoinositol, with no detected activity toward related substrates such as glycerophosphoinositol 4-phosphate, glycerophosphocholine, glycerophosphoethanolamine, and glycerophosphoserine .

The enzymatic reaction catalyzed by GDPD2 produces inositol 1-phosphate and glycerol as final products, contributing to phosphoinositide signaling pathways and glycerophospholipid metabolism . These pathways are critical for various cellular processes including membrane dynamics, signal transduction, and cellular differentiation.

The following table summarizes the functional characteristics of GDPD2:

FunctionDescription
Enzymatic ActivityGlycerophosphoinositol inositolphosphodiesterase
Substrate SpecificityHydrolyzes glycerophosphoinositol specifically
ProductsInositol 1-phosphate and glycerol
Non-reactive SubstratesGlycerophosphoinositol 4-phosphate, glycerophosphocholine, glycerophosphoethanolamine, glycerophosphoserine
Biological ProcessesGlycerol metabolic process, lipid metabolic process
Specific FunctionsAccelerates osteoblast differentiation and growth, may play role in actin cytoskeleton remodeling

Beyond its enzymatic functions, GDPD2 plays a role in accelerating osteoblast differentiation and growth, suggesting its importance in bone development and metabolism . Additionally, evidence indicates that GDPD2 may contribute to remodeling of the actin cytoskeleton, though some of these functional attributes have been noted as determined "by similarity" rather than direct experimental validation .

Production of Recombinant Human GDPD2

Recombinant human GDPD2 has been produced using several expression systems for research and commercial applications. One established approach involves expressing the full-length open reading frame (ORF) of human GDPD2 (NP_060181.2, amino acids 1-539) as a recombinant protein with a GST-tag at the N-terminal using a wheat germ expression system . This system is particularly advantageous for eukaryotic proteins that may require specific post-translational modifications for proper folding and function.

Alternative production methods include cell-free protein synthesis (CFPS), which has been successfully employed to generate recombinant human GDPD2 conjugated to a Strep tag . CFPS systems offer distinct advantages, including rapid production timeframes and the ability to express proteins that may be toxic to host cells.

For optimal stability and activity, recombinant GDPD2 is typically stored at -80°C with recommendations to prepare aliquots to minimize freeze-thaw cycles . The recommended storage buffer for GST-tagged GDPD2 consists of 50 mM Tris-HCI with 10 mM reduced Glutathione at pH 8.0 . For maximum activity, the protein should ideally be used within three months from receipt .

Biological Roles and Cellular Functions

GDPD2 participates in several important biological processes with particular significance in osteoblast differentiation and growth, as reflected in its synonym OBDPF (osteoblast differentiation promoting factor) . This function suggests a critical role in bone development and maintenance that may have clinical implications.

The enzyme contributes to glycerol and lipid metabolic processes through its activity in hydrolyzing glycerophosphoinositol . This metabolic function potentially influences membrane composition, fluidity, and signaling capabilities, with broader implications for cellular homeostasis.

While detailed mechanisms of GDPD2's influence on osteoblast differentiation remain to be fully elucidated, its involvement in actin cytoskeleton remodeling may provide insights into this process . The actin cytoskeleton is fundamental for cell morphology, migration, and division—all critical aspects of osteoblast function and bone formation.

GDPD2 in Agricultural Applications and Plant Research

Recent research on GDPD2 homologs in plants, particularly in soybeans (Glycine max), has revealed significant roles in phosphorus utilization and plant development. The soybean homolog, GmGDPD2, has been identified as a major quantitative trait locus (QTL) gene controlling root architecture and phosphorus efficiency traits .

Studies demonstrate that overexpression of GmGDPD2 in soybeans significantly enhances root system development under both normal phosphorus (NP) and low phosphorus (LP) conditions . This improved root architecture directly contributes to enhanced phosphorus content (PC) and phosphorus acquisition efficiency (PAE), with particularly pronounced benefits under phosphorus-limited growing conditions .

The following table summarizes the effects of GmGDPD2 modification on various agricultural traits:

ParameterEffect of GmGDPD2 OverexpressionEffect of GmGDPD2 Knockout
Root Traits35.2% to 55.1% increase35.3% to 59.9% decrease
Phosphorus Content (NP conditions)35.2% increase38.3% decrease
Phosphorus Acquisition Efficiency (NP conditions)50% increase60.9% decrease
Phosphorus Content (LP conditions)64.3% increaseData not provided
Phosphorus Acquisition Efficiency (LP conditions)92.3% increaseData not provided
Yield35.1% increaseDecrease (value not specified)
Branch Number121% increaseDecrease (value not specified)
Pod Number25.0% increaseDecrease (value not specified)
100-seed Weight38.10% increaseDecrease (value not specified)

Field studies further revealed that plants overexpressing GmGDPD2 exhibited significantly improved yield-related traits, including increased yield (35.1%), branch number (121%), pod number (25.0%), and 100-seed weight (38.10%) compared to wild-type plants . Conversely, knockout of GmGDPD2 resulted in reductions in these agricultural performance metrics .

These findings position GDPD2 as a promising target for agricultural improvement, particularly for enhancing crop performance under phosphorus-limited conditions. The ability of GDPD2 to simultaneously improve phosphorus efficiency and yield traits makes it particularly valuable for sustainable agricultural applications in regions with phosphorus-deficient soils.

Research Applications and Experimental Methods

Recombinant human GDPD2 serves multiple research applications across various experimental platforms. The purified protein can be utilized in numerous techniques including:

  1. Enzyme-linked Immunosorbent Assay (ELISA): For detection, quantification, and interaction studies involving GDPD2 .

  2. Western Blot analysis: Employing recombinant GDPD2 as a positive control or standard in protein detection assays .

  3. Antibody Production: Using the purified protein as an antigen for generating specific antibodies against GDPD2, which can subsequently be applied in various immunological techniques .

  4. Protein Array applications: For high-throughput studies of protein-protein interactions or functional analyses in complex biological systems .

Detection and characterization of GDPD2 activity typically involve enzymatic assays measuring the production of inositol 1-phosphate and glycerol from glycerophosphoinositol substrates. These assays are essential for understanding the kinetic properties of the enzyme and evaluating potential modulators of its activity.

The availability of differently tagged recombinant forms of GDPD2 (GST-tag, Strep-tag) provides researchers with flexibility in experimental design and detection methodologies . These tagged variants facilitate protein purification through affinity chromatography techniques and enable detection using tag-specific antibodies or reagents.

Future Perspectives and Research Directions

Recombinant Human GDPD2 represents a significant enzyme with emerging roles in both biomedical and agricultural applications. The demonstrated functions in osteoblast differentiation suggest potential relevance to bone health and development, possibly opening avenues for therapeutic interventions in bone-related disorders.

The agricultural applications of GDPD2 are particularly promising, with evidence supporting its role in enhancing phosphorus efficiency and yield traits in crops. This dual benefit positions GDPD2 as a valuable target for developing crops with improved nutrient utilization efficiency and productivity, addressing challenges in sustainable agriculture.

Future research directions may include:

  1. Detailed structural studies of GDPD2 to elucidate the molecular basis of its substrate specificity and catalytic mechanism.

  2. Investigation of GDPD2's role in human disease contexts, particularly in bone disorders and metabolic conditions.

  3. Further exploration of the regulatory mechanisms controlling GDPD2 expression and activity in different cellular contexts.

  4. Development of targeted approaches to modulate GDPD2 activity for therapeutic or agricultural applications.

  5. Comparative studies across species to understand the evolutionary conservation and divergence of GDPD2 functions.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate them in your order remarks. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it according to your request.
Synonyms
GDPD2; GDE3; OBDPF; UNQ1935/PRO4418; Glycerophosphoinositol inositolphosphodiesterase GDPD2; Glycerophosphodiester phosphodiesterase 3; Glycerophosphodiester phosphodiesterase domain-containing protein 2; Osteoblast differentiation promoting factor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GDPD2
Target Protein Sequence
MAESPGCCSVWARCLHCLYSCHWRKCPRERMQTSKCDCIWFGLLFLTFLLSLSWLYIGLV LLNDLHNFNEFLFRRWGHWMDWSLAFLLVISLLVTYASLLLVLALLLRLCRQPLHLHSLH KVLLLLIMLLVAAGLVGLDIQWQQEWHSLRVSLQATAPFLHIGAAAGIALLAWPVADTFY RIHRRGPKILLLLLFFGVVLVIYLAPLCISSPCIMEPRDLPPKPGLVGHRGAPMLAPENT LMSLRKTAECGATVFETDVMVSSDGVPFLMHDEHLSRTTNVASVFPTRITAHSSDFSWTE LKRLNAGSWFLERRPFWGAKPLAGPDQKEAESQTVPALEELLEEAAALNLSIMFDLRRPP QNHTYYDTFVIQTLETVLNARVPQAMVFWLPDEDRANVQRRAPGMRQIYGRQGGNRTERP QFLNLPYQDLPLLDIKALHKDNVSVNLFVVNKPWLFSLLWCAGVDSVTTNDCQLLQQMRY PIWLITPQTYLIIWVITNCVSTMLLLWTFLLQRRFVKKRGKTGLETAVLLTRINNFMME
Uniprot No.

Target Background

Function
Glycerophosphoinositol inositolphosphodiesterase (GDPD2) exhibits glycerophosphoinositol inositolphosphodiesterase activity and specifically hydrolyzes glycerophosphoinositol. It does not exhibit activity towards other substrates such as glycerophosphoinositol 4-phosphate, glycerophosphocholine, glycerophosphoethanolamine, and glycerophosphoserine. GDPD2 accelerates the program of osteoblast differentiation and growth. It may play a role in remodeling of the actin cytoskeleton.
Gene References Into Functions
  1. These findings establish GDE3 as a negative regulator of the uPAR signaling network. Furthermore, they highlight GPI-anchor hydrolysis as a cell-intrinsic mechanism that can alter cell behavior. PMID: 28849762
  2. GDE3 is a novel seven-transmembrane protein with a GP-PDE-like extracellular motif expressed during osteoblast differentiation. It accelerates the program of osteoblast differentiation and is involved in morphological changes of cells. PMID: 12933806
  3. GDE3 substrate GroPIns is a candidate mediator for osteoblast proliferation. PMID: 19596859
Database Links

HGNC: 25974

OMIM: 300940

KEGG: hsa:54857

UniGene: Hs.438712

Protein Families
Glycerophosphoryl diester phosphodiesterase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.

Q&A

What is GDPD2 and what is its primary function?

GDPD2, also known as glycerophosphodiester phosphodiesterase domain containing 2 (GDE3), is a member of the glycerophosphodiester phosphodiesterase enzyme family. The primary function of GDPD2 is to hydrolyze glycerophosphoinositol (GroPI) to produce inositol 1-phosphate (Ins1p1) and glycerol. This enzyme plays significant roles in lipid metabolism and has been implicated in osteoblast differentiation and growth regulation . When studying GDPD2 function, researchers should consider its subcellular localization, as it is a transmembrane protein with an external enzymatic domain associated with bacterial glycerophosphodiester phosphodiesterase .

What is the molecular structure and genetic information for human GDPD2?

Human GDPD2 is encoded by the GDPD2 gene located on the X chromosome. The full-length protein consists of 539 amino acids with a molecular mass of approximately 88.1 kDa when tagged with GST . The protein sequence contains transmembrane domains and a catalytic domain responsible for its enzymatic activity. For genetic studies, researchers should note that:

ParameterInformation
Official SymbolGDPD2
Gene ID54857
mRNA RefseqNM_001171191
Protein RefseqNP_001164662
UniProt IDQ9HCC8
SynonymsFLJ20207, GDE3, OBDPF
Chromosomal LocationX chromosome

When designing experiments involving GDPD2, consider alternative splicing as multiple transcript variants exist .

What are the optimal methods for studying GDPD2 expression and activity in vitro?

For comprehensive GDPD2 expression and activity analysis, a multi-method approach is recommended:

  • Expression Analysis:

    • qPCR for transcript quantification (primers targeting exon junctions to distinguish splice variants)

    • Western blot with specific antibodies for protein levels

    • Immunofluorescence for subcellular localization

  • Activity Assays:

    • Enzymatic activity can be measured by quantifying the production of Ins1p1 and glycerol

    • Recombinant protein expression systems (such as GST-tagged GDPD2) for in vitro activity assays

  • Cellular Function:

    • Organoid culture systems to study GDPD2's effect on cell proliferation

    • Feeder-free and feeder organoid models for studying different aspects of GDPD2 function

When designing these experiments, control for variables such as cell type, culture conditions, and passage number to ensure reproducibility of results. Include appropriate positive and negative controls, and validate findings with multiple methodological approaches.

How should researchers design knockout or knockdown experiments to study GDPD2 function?

When designing genetic manipulation experiments for GDPD2:

  • CRISPR/Cas9 KO Strategy:

    • Target early exons to ensure complete loss of function

    • Consider the X-chromosomal location when designing knockout strategies for male versus female subjects

    • Validate knockout by sequencing, protein expression analysis, and enzymatic activity assays

  • siRNA/shRNA Knockdown:

    • Design multiple siRNAs targeting different regions of GDPD2 mRNA

    • Use scrambled siRNA controls

    • Validate knockdown efficiency at both mRNA and protein levels

  • Phenotype Analysis:

    • Include both in vitro (cell proliferation, differentiation) and in vivo measurements

    • Consider tissue-specific effects, as GDPD2 function may vary between cell types

Recent studies have demonstrated that Gdpd2 knockout mice exhibit increased club cell proliferation but reduced goblet cell differentiation during ovalbumin-induced allergic inflammation, suggesting context-dependent functions .

What role does GDPD2 play in cell proliferation and differentiation?

GDPD2 demonstrates complex, context-dependent effects on cell proliferation and differentiation:

  • Anti-proliferative Effects:

    • Gdpd2 has been shown to negatively regulate cell proliferation in several contexts

    • Gdpd2 overexpression slowed tumor growth in a mouse xenograft model

    • It inhibited oligodendrocyte precursor cell proliferation via ciliary neurotrophic factor receptor α

  • Pro-differentiation Effects:

    • GDPD2 is considered a marker of osteoblast differentiation

    • It may promote goblet cell differentiation during airway inflammation

  • Context-dependent Effects:

    • In homeostasis versus inflammatory conditions, GDPD2 exhibits opposing effects

    • Gdpd2 KO mice showed increased club cell proliferation during inflammation but decreased proliferation in steady-state organoid cultures

This paradoxical behavior may be related to different metabolic pathways being activated in different physiological contexts. When designing experiments, researchers should carefully consider the physiological state of their model system.

What is the relationship between GDPD2 and nitric oxide signaling?

Research has revealed a significant relationship between nitric oxide (NO) and GDPD2:

  • NO Regulation of GDPD2:

    • NO donor diethylamine NONOate upregulates Gdpd2 expression in club cells

    • This upregulation was confirmed by both bulk RNA-Seq and qPCR analysis of sorted club cells

  • Functional Consequences:

    • NO-induced GDPD2 upregulation inhibits club cell proliferation

    • This pathway may be involved in airway epithelial damage in severe asthma

    • Blockade of the NO-GDPD2 pathway may promote airway epithelial restoration

  • Metabolite Production:

    • GDPD2 catalyzes production of glycerol and Ins1p1

    • These metabolites appear to be downstream NO mediators inhibiting club cell proliferation

ConditionGDPD2 ExpressionEffect on Club Cells
NO Donor TreatmentUpregulatedInhibited proliferation
Normal (Control)BaselineNormal proliferation
Gdpd2 KO + OVAAbsentEnhanced proliferation, reduced goblet cell differentiation

When studying this pathway, researchers should measure both NO levels and GDPD2 expression to establish proper correlations.

How can researchers address the contradictory findings on GDPD2's role in different contexts?

To address the context-dependent roles of GDPD2, researchers should:

  • Design Multi-context Experiments:

    • Study GDPD2 function in both homeostatic and inflammatory/pathological conditions

    • Compare in vitro versus in vivo models

    • Use both gain-of-function and loss-of-function approaches

  • Investigate Metabolic Pathways:

    • Track the fate of GDPD2 metabolites (glycerol and Ins1p1) in different cellular contexts

    • Identify potential alternative metabolic pathways that may be activated in different conditions

    • Consider that "glycerol may exert different functions under various pathological conditions"

  • Consider Niche Environment:

    • As noted in the literature, "a niche environment is essential for redirecting club cell regulation by Gdpd2"

    • Study cell-cell interactions and extracellular signals that might modify GDPD2 function

    • Analyze the effects of inflammatory mediators on GDPD2 function

  • Temporal Analysis:

    • Conduct time-course experiments to determine if GDPD2 functions change over time

    • Investigate acute versus chronic effects of GDPD2 activation/inhibition

By systematically addressing these variables, researchers can help reconcile seemingly contradictory findings.

What are the methodological considerations for studying GDPD2 catalytic products?

When studying GDPD2's catalytic products (glycerol and Ins1p1):

  • Analytical Methods:

    • Use high-performance liquid chromatography (HPLC) or mass spectrometry to quantify Ins1p1

    • Employ enzymatic assays or colorimetric methods for glycerol quantification

    • Consider stable isotope labeling to track metabolite flux

  • Functional Assessment:

    • Test the effects of exogenous glycerol and Ins1p1 on cellular processes

    • Use concentration ranges that mimic physiological levels produced by GDPD2

    • Include time-course analyses to identify immediate versus delayed effects

  • Downstream Pathway Analysis:

    • Investigate how glycerol enters subsequent metabolic pathways

    • Study how glycerol may be converted to glycerol-3-phosphate (Gro3P)

    • Examine how Ins1p1 interacts with other inositol phosphate signaling components

  • Controls and Validation:

    • Include appropriate vehicle controls

    • Confirm specificity by using structurally related but non-functional analogs

    • Validate findings using genetic approaches (GDPD2 KO/knockdown)

These methodological considerations will help ensure rigorous investigation of GDPD2 catalytic functions.

What evidence exists for GDPD2's involvement in inflammatory and respiratory diseases?

Research indicates several potential roles for GDPD2 in inflammatory and respiratory conditions:

  • Asthma and Airway Inflammation:

    • GDPD2 is upregulated during ovalbumin (OVA)-induced allergic airway inflammation

    • Gdpd2 knockout promotes club cell proliferation but inhibits goblet cell differentiation during OVA challenge

    • This suggests GDPD2 may contribute to airway remodeling in asthma

  • Nitric Oxide-Mediated Airway Damage:

    • In severe asthma, excessive NO is often observed in patient airways

    • NO upregulates GDPD2, which may contribute to airway epithelial damage

    • Targeting the NO-GDPD2 pathway might be beneficial for airway epithelial restoration

  • Cell Death and Repair:

    • GDPD2 may contribute to NO-induced apoptosis and cell cycle arrest

    • This could impair tissue regeneration in chronic inflammatory conditions

When designing studies to investigate GDPD2 in disease models, researchers should include appropriate disease controls and consider both acute and chronic phases of the disease process.

How should researchers design experiments to evaluate GDPD2 as a potential therapeutic target?

When evaluating GDPD2 as a therapeutic target:

  • Target Validation:

    • Confirm GDPD2 expression/activity in relevant human disease tissues

    • Use conditional knockout models to establish temporal requirements for GDPD2 inhibition

    • Determine if GDPD2 inhibition after disease onset can reverse pathology

  • Inhibitor Development and Testing:

    • Design small molecule inhibitors targeting GDPD2's catalytic domain

    • Test inhibitor specificity against related glycerophosphodiester phosphodiesterases

    • Evaluate pharmacokinetics and tissue distribution, particularly in target organs

  • Efficacy Studies:

    • Use established disease models that reflect the human condition

    • Include both preventive and therapeutic treatment regimens

    • Measure both molecular endpoints (GDPD2 activity, downstream pathways) and physiological outcomes

  • Safety Assessment:

    • Evaluate effects on normal cell function, as GDPD2 plays roles in homeostasis

    • Consider potential compensatory mechanisms (upregulation of related enzymes)

    • Assess long-term consequences of GDPD2 inhibition on development and tissue maintenance

According to current research, "blockade of the NO-GDPD2 pathway may be beneficial for airway epithelial restoration" , suggesting therapeutic potential in respiratory conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.