Recombinant Human Glycine receptor subunit alpha-4 (GLRA4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-417
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
GLRA4
Target Protein Sequence
KEEVKSGTKGSQPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFSSITKT TMDYRVNVFLRQQWNDPRLSYREYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTD NKLLRIFKNGNVLYSIRLTLILSCLMDLKNFPMDIQTCTMQLESFGYTMKDLVFEWLEDA PAVQVAEGLTLPQFILRDEKDLGCCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLL IVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLF VFAALLEYAAINFVSRQHKEFIRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGG PMEGSGIYSPQPPAPLLREGETTRKLYVD
Uniprot No.

Q&A

What is the current consensus on the functional status of human GLRA4?

Human GLRA4 is widely considered a pseudogene due to multiple inactivating mutations. The most notable is an in-frame stop codon at position 390 (X390) within the fourth membrane-spanning domain (M4), preventing translation of a full-length functional protein. Additionally, bioinformatic and mutagenesis analyses have revealed other damaging substitutions, particularly at position K59, that further ablate human GLRA4 function. These critical inactivating mutations are not present in most other vertebrate GLRA4 sequences, where the gene remains functional . Genomic analysis indicates these inactivating mutations have been present for at least 30,000-50,000 years, as they were also found in ancient Denisovan individuals .

How does GLRA4 expression differ between humans and other species?

Unlike the non-functional human version, GLRA4 shows tissue-specific expression patterns in other species. In mice, single-cell RNA sequencing has identified Glra4 expression in a limited number of cells in the cortex, striatum, thalamus, midbrain, and spinal cord . In zebrafish, which possess duplicated genes (glra4a and glra4b), expression patterns are more differentiated - glra4b expression is restricted to the retina, while glra4a is strongly expressed in spinal cord and hindbrain commissural neurons . These expression differences highlight the evolutionary divergence of GLRA4 function across species.

What mechanisms have been explored to potentially restore human GLRA4 function?

More comprehensive mutagenesis strategies targeted multiple potentially damaging residues. Electrophysiological studies confirmed that combined mutations (K59E/C204Y/X390R or K59E/X390R/W421R) could partially restore glycine sensitivity, though with altered EC50 values compared to functional mouse α4 GlyRs . The table below summarizes the glycine EC50 values for various GlyR constructs:

GlyR ConstructGlycine EC50 (μM)Functional Status
Human α164 ± 8Fully functional
Mouse α498 ± 14Fully functional
Human α4 K59E/C204Y/X390R33 ± 3Partially restored
Human α4 K59E/X390R/W421R38 ± 2Partially restored
Human α4 K59E/C204Y/X390Non-functional aloneNon-functional
Human α4 K59E/C204Y/X390 + Human α1350 ± 29Altered function when co-assembled

How do truncated forms of GLRA4 potentially interact with other glycine receptor subunits?

While the native human GLRA4 (with X390) does not contribute to functional glycine receptors independently, research has explored whether it might act as a negative regulator through co-assembly with other GlyR subtypes. Electrophysiological studies demonstrated that a modified truncated form (α4 K59E/C204Y/X390) could co-assemble with wild-type human GlyR α1 subunits, significantly increasing the glycine EC50 from 64 ± 8 to 350 ± 29 μM . This suggests altered receptor pharmacology when co-assembly occurs.

What are the evolutionary implications of GLRA4 pseudogenization in humans?

The pseudogenization of GLRA4 in humans represents an intriguing case of human-specific gene loss. Comprehensive sequence analysis across vertebrates indicates that functional GLRA4 genes are present in the majority of vertebrate species, with humans being a notable exception . The identification of inactivating mutations (X390 and K59) in both modern humans and ancient Denisovan genomes places the pseudogenization event at least 30,000-50,000 years ago .

This evolutionary trajectory raises important questions about selective pressures and functional compensation. Given that GLRA4 contributes to escape behaviors in zebrafish, its loss in humans might reflect changes in neurological requirements during human evolution. The retained functionality in closely related primates (gorilla and chimpanzee) further highlights the recency and specificity of this evolutionary change in humans .

What models are appropriate for studying GLRA4 function given its pseudogene status in humans?

Given the non-functional nature of human GLRA4, researchers investigating its physiological roles must carefully select appropriate model systems. Several approaches have proven valuable:

  • Non-human primate models: Since gorilla and chimpanzee GLRA4 remain functional, these models can provide insights into the ancestral function of GLRA4 in primates. Expression of artificially synthesized gorilla and chimp GlyR α4 subunit cDNAs generates robust glycine-gated anion influxes in experimental systems .

  • Rodent models: Mouse Glra4 is functional and can be studied both in vivo and in heterologous expression systems. Mouse α4 GlyRs demonstrate distinct pharmacological and biophysical properties that may inform understanding of the ancestral human receptor .

  • Zebrafish models: The duplicated genes glra4a and glra4b in zebrafish offer valuable insights into tissue-specific functions. Gene knockdown and dominant-negative approaches (such as the GlyR α4a R278Q mutant) have successfully demonstrated contributions to touch-evoked escape behaviors .

  • Heterologous expression systems: HEK293 cells expressing mouse, gorilla, or artificially corrected human GLRA4 constructs allow detailed electrophysiological and pharmacological characterization using patch-clamp techniques and fluorescent membrane potential dyes .

What methodological approaches can be used to assess GLRA4 expression patterns?

Multiple complementary techniques have been employed to characterize GLRA4 expression:

  • Single-cell RNA sequencing: Re-analysis of existing datasets (e.g., Zeisel et al., 2018) has revealed cell-type specific expression patterns across brain regions. This approach identified limited Glra4 expression in specific cells of the cortex, striatum, thalamus, midbrain, and spinal cord in mice .

  • Quantitative real-time PCR (qRT-PCR): Bulk qRT-PCR analysis can quantify region-specific expression levels. This approach has been used to detect Glra1 expression in the hypothalamus, thalamus, brainstem, and spinal cord, while also characterizing the more widespread but low expression of Glra2 and Glrb .

  • Gene trap lines: Novel tol2-GAL4FF gene trap lines (such as SAIGFF16B) have been developed in zebrafish to visualize glra4a expression, revealing strong expression in spinal cord and hindbrain commissural neurons .

  • Comparative expression analysis: Sex-specific expression differences have been explored by comparing mRNA profiles in female and male mice, providing insights into potential sexually dimorphic functions of glycine receptor subunits .

What electrophysiological protocols are most effective for characterizing α4-containing glycine receptors?

For functional characterization of α4-containing GlyRs, several electrophysiological approaches have proven valuable:

  • Whole-cell patch-clamp recordings: This technique allows precise measurement of glycine-evoked currents and determination of concentration-response relationships. Key parameters such as EC50 values, Hill coefficients, and current amplitudes can be quantified to compare wild-type and mutant receptors .

  • Artificial synapse formation: Co-culture systems where glycinergic presynaptic terminals form connections with HEK293 cells expressing recombinant GlyRs enable characterization of synaptic currents. This approach revealed that mouse and gorilla α4β GlyRs mediate synaptic currents with unusually slow decay kinetics .

  • Fluorescent membrane potential assays: High-throughput screening of GlyR function can be performed using fluorescent membrane potential-sensitive dyes. This approach allows rapid comparison of multiple constructs and has been used to identify key residues affecting GlyR α4 function .

How should researchers interpret contradictory findings regarding GLRA4's role in human disease?

Despite GLRA4's pseudogene status, a case report has implicated it in intellectual disability, behavioral problems, and craniofacial anomalies. An 11-year-old female patient with these symptoms was reported to have a de novo Xq22.2 110 kb microdeletion encompassing GLRA4, MORF4L2, and TCEAL . This presents an apparent contradiction to functional studies.

When interpreting such conflicting evidence, researchers should consider:

  • Causality vs. correlation: The microdeletion affecting GLRA4 also impacts other genes (MORF4L2 and TCEAL) that may be responsible for the observed phenotype.

  • Alternative splicing possibilities: While experimental evidence argues against alternative splicing restoring GLRA4 function, tissue-specific or context-dependent splicing cannot be entirely excluded.

  • Non-protein coding functions: GLRA4 transcripts, despite not producing functional proteins, might have regulatory roles affecting other genes' expression.

  • Methodological limitations: Functional studies in heterologous systems may not fully recapitulate the complex genomic context within human neurons.

A comprehensive approach to resolving these contradictions would include genome-wide association studies with larger cohorts, targeted sequencing of GLRA4 in patients with similar phenotypes, and exploration of potential regulatory roles for GLRA4 transcripts.

What are the key challenges in developing recombinant human GLRA4 for research applications?

Developing recombinant human GLRA4 for research presents several challenges:

  • Functional limitations: The native human GLRA4 is non-functional due to multiple inactivating mutations. Researchers must decide whether to use the native sequence (for studying the pseudogene itself) or create artificially "corrected" versions to study potential ancestral functions.

  • Multiple inactivating mutations: Restoring function requires correcting multiple mutations (at minimum K59E and X390R), complicating construct design and potentially creating artificial proteins that never existed in humans .

  • Expression optimization: Even with corrected mutations, expression levels may be suboptimal due to codon usage or other sequence features that have evolved under reduced selective pressure.

  • Functional validation: Without a natural reference for human GLRA4 function, validating recombinant constructs relies on comparative analysis with other species or other glycine receptor subtypes.

  • Relevance concerns: Given its pseudogene status in humans for at least 30,000-50,000 years, the physiological relevance of studying "corrected" human GLRA4 must be carefully considered and justified in research contexts.

How can researchers accurately compare GLRA4 function across species given the human pseudogenization?

Cross-species functional comparison of GLRA4 requires careful methodological considerations:

  • Standardized expression systems: Using identical heterologous expression systems (e.g., HEK293 cells) and transfection protocols for all species variants ensures differences observed are due to sequence variations rather than experimental conditions.

  • Equivalent construct design: Ensuring comparable signal peptides, tags, and vector contexts minimizes non-specific effects on expression or function.

  • Phylogenetic normalization: Interpreting functional differences within their evolutionary context requires comprehensive phylogenetic analysis. The functional gorilla and chimp GLRA4, despite carrying some potentially damaging mutations (e.g., Cys204), offer particularly valuable comparisons to human GLRA4 .

  • Multiple functional readouts: Combining electrophysiological measurements, protein expression quantification, trafficking analysis, and interaction studies provides a more complete picture of functional differences.

  • Chimeric constructs: Creating chimeric receptors where specific domains are swapped between human and functional species variants can pinpoint which regions contribute most significantly to functional differences.

What novel methodologies might resolve outstanding questions about human GLRA4 function?

Several emerging technologies and approaches could address key knowledge gaps:

  • CRISPR/Cas9 knock-in models: Introducing "humanized" GLRA4 (with the X390 stop codon and K59 variant) into model organisms with functional GLRA4 could reveal compensatory mechanisms that evolved following human pseudogenization.

  • Single-cell transcriptomics in human brain tissues: Comprehensive analysis across developmental stages and brain regions might reveal if GLRA4 transcripts show specific expression patterns despite their non-coding status, suggesting potential regulatory functions.

  • Long-read sequencing: Application to human GLRA4 locus might identify previously undetected splice variants or genomic features that could affect gene function.

  • Proteomics approaches: Targeted mass spectrometry could definitively determine whether any GLRA4 protein products exist in human tissues, potentially through non-canonical translation mechanisms.

  • Computational modeling: Molecular dynamics simulations comparing human GLRA4 (with restored X390R) to functional orthologs might predict structural abnormalities beyond the identified key mutations that contribute to dysfunction.

What insights might comparative studies of zebrafish glra4a and glra4b provide for understanding the ancestral function of human GLRA4?

Zebrafish models offer unique advantages for understanding GLRA4 function:

  • Functional specialization: The gene duplication in zebrafish (glra4a and glra4b) has allowed subfunctionalization, with distinct expression patterns and potentially specialized functions. Studying both paralogs can provide insights into the range of functions ancestral GLRA4 might have served before human pseudogenization .

  • Behavioral relevance: Functional studies have demonstrated that glra4a contributes to touch-evoked escape behaviors in zebrafish. This suggests ancestral GLRA4 may have played a role in startle or escape responses, which aligns with the general inhibitory function of glycine receptors in controlling excitability .

  • Developmental trajectories: Examining the developmental expression patterns of glra4a and glra4b could reveal temporally specific functions that might be relevant to understanding the potential impact of GLRA4 loss in humans.

  • Circuit integration: The strong expression of glra4a in commissural neurons of the spinal cord and hindbrain suggests involvement in specific neural circuits. Detailed circuit mapping in zebrafish could identify analogous human circuits that may have adapted following GLRA4 pseudogenization .

What are the broader implications of GLRA4 pseudogenization for understanding human evolution and neurobiology?

The pseudogenization of GLRA4 in humans represents a fascinating case study in human-specific gene loss and adaptation. Several key implications emerge:

  • Evolutionary trade-offs: The loss of functional GLRA4 approximately 30,000-50,000 years ago coincides with a period of significant cognitive and cultural evolution in humans. This raises questions about whether GLRA4 loss might have conferred selective advantages or occurred as a neutral event during human evolution .

  • Functional compensation: The human nervous system has clearly adapted to function without GLRA4, suggesting compensatory mechanisms through other glycine receptor subunits or alternative inhibitory systems. Understanding these compensatory adaptations could provide insights into neural plasticity and redundancy.

  • Disease relevance reconsideration: The association of GLRA4 deletion with neurodevelopmental disorders warrants careful reassessment. If GLRA4 itself is non-functional, observed phenotypes may result from regulatory effects on neighboring genes or from the loss of non-protein-coding functions of GLRA4 transcripts .

  • Evolutionary medicine perspective: The human-specific loss of GLRA4 function offers a window into the ongoing process of genomic adaptation and how loss-of-function events can be integrated into species evolution without catastrophic consequences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.