Recombinant Human Glycophorin-C (GYPC)

Shipped with Ice Packs
In Stock

Description

Recombinant GYPC Production

Recombinant GYPC is synthesized using eukaryotic expression systems to ensure proper post-translational modifications. Key production parameters are summarized below:

ParameterHEK293T Cells Baculovirus
TagC-Myc/DDKHis-Tag
Purity>80% (SDS-PAGE) >95% (SDS-PAGE)
Molecular Weight11.7 kDa (predicted) 7.2–28 kDa (observed)
Sequence1–57 aa fragment 1–57 aa fragment
Storage-80°C (stable ≥12 months) -80°C (avoid freeze-thaw)

Notes:

  • Discrepancies in molecular weight arise from glycosylation and electrophoresis conditions .

  • The 1–57 aa fragment corresponds to the extracellular domain, which hosts Gerbich blood group antigens and Plasmodium falciparum binding sites .

Erythrocyte Mechanostability Studies

Recombinant GYPC is used to investigate its interaction with cytoskeletal proteins. For example:

  • Band 4.1 Binding: The cytoplasmic domain (residues 82–98) binds band 4.1 with a force of ~6.9 µN/m, critical for erythrocyte deformability .

  • Pathogenic Mutations: Deletions in exons 2–3 (Gerbich/Yus phenotypes) reduce membrane stability and confer malaria resistance .

Malaria Pathogenesis

GYPC is a receptor for Plasmodium falciparum EBA-140 ligand:

  • Binding Mechanism: Requires an N-linked glycan on GPC (absent in GPD) .

  • Evolutionary Insight: Accelerated evolution of GYPC in humans correlates with malaria-driven selection .

Blood Group Systems

  • Gerbich Antigens: Recombinant GYPC helps characterize Ge2/Ge3/Ge4 epitopes, which are absent in Ge– phenotypes linked to ovalocytosis .

Key Research Findings

Study FocusKey ResultSource
Structural EvolutionHuman-specific GPC translation start codon arose via C→A mutation .
Malaria ResistanceGe– erythrocytes resist P. falciparum invasion due to EBA-140 binding loss .
Recombinant Protein UtilityHis-tagged GYPC (1–57 aa) used in SDS-PAGE/ELISA for antibody validation .

Future Directions

  • Therapeutic Targets: Blocking GYPC–EBA-140 interaction to inhibit malaria invasion .

  • Genetic Studies: Role of GYPC polymorphisms in global malaria susceptibility .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
GYPC; GLPC; GPC; Glycophorin-C; Glycoconnectin; Glycophorin-D; GPD; Glycoprotein beta; PAS-2'; Sialoglycoprotein D; CD antigen CD236
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GYPC
Target Protein Sequence
MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Uniprot No.

Target Background

Function
Glycophorin-C is a minor sialoglycoprotein found in human erythrocyte membranes. The Gerbich blood group antigens and receptors for Plasmodium falciparum merozoites are likely located within its extracellular domain. Glycophorin-C plays a crucial role in regulating the stability of red blood cells.
Gene References Into Functions
  1. The authors aimed to elucidate the similarities and differences between the GYPC deletion alleles Yus and Gerbich by conducting positional PCR sequence analysis to identify the breakpoints. They developed a set of diagnostic PCRs that can classify both Yus and Gerbich phenotypic variants based on their nucleotide deletion. The Yus phenotype was characterized by 4 distinct breakpoints, and the Ger PMID: 28272739
  2. Plasmodium falciparum STEVOR functions as an erythrocyte-binding protein that recognizes Glycophorin C (GPC) on the red blood cell (RBC) surface. Its binding correlates with the level of GPC on the RBC surface. PMID: 25011110
  3. Rosetting assays using CD236R knockdown normocytes derived from hematopoietic stem cells further support the role of glycophorin C as a receptor in P vivax rosette formation. PMID: 24652986
  4. Precise definition of the binding site for the EBA-140 ligand on glycophorin C is essential for developing human erythrocyte invasion inhibition strategies based on a receptor. PMID: 24379273
  5. Glycophorin C delta (exon3) is not associated with protection against severe anemia in Papua New Guinea. PMID: 21061946
  6. The Gerbich blood group system PMID: 20932076
  7. The molecular evolution of GYPC among the Hominoidea (Greater and Lesser Apes) and the pattern of polymorphism at the locus in a global human sample were examined. PMID: 19679754
  8. Recombinant Ge2, Ge3 & Ge4 antigens were cloned, expressed and purified. Yus and Ge mutants behaved in SDS-PAGE similarly to normal GPC forms with diffuse glycosylation. PMID: 12058555
  9. Data demonstrate that glycophorin C (GYPC) is the receptor for Plasmodium falciparum erythrocyte-binding antigen 140 (EBA140), mediating a primary P. falciparum invasion pathway into human erythrocytes. PMID: 12469115
  10. Glycophorin C is identified as the receptor for PfEBP-2, the erythrocyte binding ligand of Plasmodium falciparum, and the binding domain on GPC is determined to be amino acid residues 14 through 22 within exon 2. PMID: 12576308
  11. Neither mutation was associated with altered susceptibility to asymptomatic Plasmodium falciparum or P. vivax infection. Further investigation is needed to determine the contribution of these erythrocyte polymorphisms to susceptibility to clinical malaria morbidity. PMID: 14695625
  12. High GYPC gene expression is linked to an unfavorable outcome, whereas high TRIP3 gene expression is associated with a favorable outcome in childhood ALL. PMID: 19149918

Show More

Hide All

Database Links

HGNC: 4704

OMIM: 110750

KEGG: hsa:2995

STRING: 9606.ENSP00000259254

UniGene: Hs.59138

Protein Families
Glycophorin-C family
Subcellular Location
Cell membrane; Single-pass type III membrane protein. Note=Linked to the membrane via band 4.1.
Tissue Specificity
Glycophorin-C is expressed in erythrocytes. Glycophorin-D and IsoGPC are ubiquitously expressed.

Q&A

What is the molecular structure and function of Glycophorin C in human erythrocytes?

Glycophorin C (GYPC) is a minor sialoglycoprotein embedded in human erythrocyte membranes that plays a critical role in regulating red blood cell stability. The native protein consists of 128 amino acid residues and exists alongside Glycophorin D (GPD), a truncated form lacking the first 21 amino acid residues . These glycoproteins are highly glycosylated, with GYPC containing approximately 12 O-linked glycans and one N-linked glycan .

Functionally, GYPC serves as an anchor for the blood group Gerbich (Ge) antigens, which are located within its extracellular domain . This domain also contains receptors for Plasmodium falciparum merozoites, making GYPC particularly significant in malaria research . The protein's primary physiological function involves maintaining erythrocyte membrane mechanical properties, with experimental evidence confirming that alterations in GYPC expression directly affect red cell stability and deformability .

How is recombinant GYPC typically produced for research applications?

Recombinant Human Glycophorin C can be produced using several expression systems, with the two most common approaches being:

  • Baculovirus-infected insect cell expression: This system produces GYPC fragments (amino acids 1-57) with N-terminal His-tags. The resulting protein demonstrates >95% purity with endotoxin levels <1 EU/μg, making it suitable for applications requiring high purity standards .

  • Prokaryotic expression in E. coli: This approach can generate recombinant GYPC (Met1-Ile128) with N-terminal His and GST tags. The resulting protein typically shows >95% purity and is delivered as a freeze-dried powder in a buffer formulation containing 20mM Tris, 150mM NaCl, pH 8.0, with additives including 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose, and Proclin300 .

When analyzed by SDS-PAGE under reducing conditions, recombinant GYPC typically exhibits an apparent molecular mass of 55 kDa, which differs from the predicted molecular mass of 46.2 kDa . This discrepancy can be attributed to several factors including post-translational modifications, particularly glycosylation, and the relative charge distribution within the protein structure .

What are the optimal storage and stability conditions for recombinant GYPC?

Maintaining recombinant GYPC stability requires specific storage conditions depending on intended usage timeframes:

  • Short-term storage (up to one month): Store at 2-8°C in the recommended buffer (typically 20mM Tris, 150mM NaCl, pH 8.0) .

  • Long-term storage (up to 12 months): Aliquot and store at -80°C to prevent degradation .

Stability testing through accelerated thermal degradation (incubation at 37°C for 48 hours) has demonstrated that properly prepared recombinant GYPC exhibits a loss rate of less than 5% within the expiration period when stored under recommended conditions . It is crucial to avoid repeated freeze/thaw cycles as these significantly compromise protein integrity.

For reconstitution, the lyophilized protein should be dissolved in 20mM Tris, 150mM NaCl (pH 8.0) to a concentration of 0.1-1.0 mg/mL without vortexing to prevent protein denaturation .

How does the glycosylation pattern of GYPC influence its interaction with Plasmodium falciparum?

The N-glycans of GYPC play an essential role in the interaction with Plasmodium falciparum EBA-140 merozoite ligand, representing a crucial component of the parasite invasion mechanism . Detailed structural analysis using sequential mass spectrometry has revealed that GYPC N-glycans exhibit significant heterogeneity with distinctive structural features:

  • Many GYPC N-glycans contain H2 antigen structures, which serve as recognition elements for parasite binding .

  • Several GYPC N-glycans contain polylactosamine structures capped with fucose, further contributing to the molecular recognition events during parasite attachment .

This glycosylation profile is critical for characterizing the complete binding site for the EBA-140 ligand. Research methodologies for investigating these interactions typically employ glycan structure analysis through mass spectrometry followed by binding assays with recombinant EBA-140 proteins. Researchers examining these interactions should consider both the protein backbone and its glycan modifications when designing inhibitory strategies against malaria parasite invasion.

What are the significant genetic variants of GYPC and their functional implications?

The GYPC gene exhibits several clinically relevant variants associated with the Gerbich blood group system. The gene is organized in four exons distributed over 13.5 kilobase pairs (kbp) and contains two directly repeated domains of 3.4 kbp, which likely originated from the duplication of a unique ancestral domain .

Two particularly significant variants are:

  • Ge-2,-3 variant: Results from a 3.4-kbp deletion within the GPC gene, arising from unequal crossing over between the two repeated domains. This deletion removes exon 3 (amino acid residues 36-63) and creates a defective gene that still produces an unusual sialoglycoprotein on Ge-2,-3 red cells .

  • Ge-2,+3 (Yus) variant: Characterized by the deletion of amino acid residues 17-35 (encoded by exon 2), this variant also affects protein function but with different structural consequences .

These genetic variants demonstrate how internal duplication and deletion events have shaped GYPC evolution. Interestingly, the same deletion leading to the rare Ge-2,-3 genetic condition occurred spontaneously and frequently during the propagation of recombinant phages in E. coli, suggesting inherent instability in these repeated regions .

Researchers studying these variants should employ careful genetic analysis techniques along with protein expression studies to fully characterize the functional implications of these modifications.

What methodological approaches can resolve the discrepancy between predicted and observed molecular weights of recombinant GYPC?

Recombinant GYPC consistently shows a higher apparent molecular weight on SDS-PAGE (55 kDa) compared to its predicted molecular mass (46.2 kDa) . Multiple methodological approaches can help resolve this discrepancy:

  • Mass spectrometry analysis: High-resolution mass spectrometry can determine the exact mass and identify specific post-translational modifications.

  • Enzymatic deglycosylation: Treatment with specific glycosidases (PNGase F for N-linked glycans and O-glycosidase for O-linked glycans) followed by SDS-PAGE analysis can reveal the contribution of glycosylation to the apparent molecular weight.

  • Site-directed mutagenesis: Systematic mutation of potential glycosylation sites can identify which modifications contribute significantly to the molecular weight shift.

  • 2D electrophoresis: This technique separates proteins based on both isoelectric point and molecular weight, helping to identify charge-based modifications that affect migration patterns.

The observed molecular weight discrepancy likely results from several factors including:

  • Extensive O-glycosylation (approximately 12 O-linked glycans)

  • The presence of N-linked glycans with complex structures including H2 antigen and polylactosamine components

  • Potential charge effects from sialylation, which can significantly alter protein migration in SDS-PAGE

How has the evolution of human GYPC differed from other primates, and what are the implications for malaria research?

Evolutionary analysis of human GYPC has revealed evidence of recent structural changes that distinguish it from its counterparts in other primates. Research using branch-site models of molecular evolution has identified the human lineage as a "foreground branch" exhibiting distinctive evolutionary patterns .

The evolution of human GPC occurred through an unusual mechanism: the co-option of 5′ UTR sequence by the protein-coding region of the gene . This evolutionary innovation represents a significant departure from traditional models of gene evolution and suggests adaptive pressures possibly related to malaria resistance.

To investigate these evolutionary differences, researchers can employ:

  • Comparative genomics: Alignment and analysis of GYPC sequences across primate species to identify human-specific changes.

  • Branch-site tests of selection: These statistical approaches can detect positive selection (ω > 1) acting on specific sites in the human lineage against a background of negative selection (ω < 1) or neutral evolution (ω = 1) in other lineages .

  • Functional binding studies: Comparing the interaction between Plasmodium falciparum EBA-140 and GYPC from different primate species can reveal how evolutionary changes have affected malaria parasite recognition.

The human-specific changes in GYPC structure may explain differences in susceptibility to Plasmodium falciparum between humans and other primates, making this an important area for malaria researchers investigating host-parasite co-evolution.

What are optimal validation methods for confirming recombinant GYPC identity and functionality?

When validating recombinant GYPC preparations, researchers should implement multiple complementary approaches:

  • Protein identity confirmation:

    • SDS-PAGE analysis under reducing conditions (15% gels recommended)

    • Western blotting with specific anti-GYPC antibodies

    • Mass spectrometry for sequence verification and post-translational modification mapping

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to analyze secondary structure elements

    • Size exclusion chromatography to verify monodispersity and absence of aggregation

    • Glycan profiling using lectin binding assays or mass spectrometry

  • Functional validation:

    • Binding assays with Plasmodium falciparum EBA-140 merozoite ligand

    • Interaction studies with cytoskeletal proteins that normally associate with GYPC in erythrocyte membranes

    • Competitive inhibition assays against native GYPC

Researchers should be aware that recombinant GYPC typically shows a higher molecular weight on SDS-PAGE (18-28 kDa) than predicted based on amino acid sequence alone, due to extensive glycosylation . Appropriate positive controls (e.g., erythrocyte membrane extracts) should be included in validation experiments.

How can researchers effectively study the role of GYPC N-glycans in Plasmodium falciparum interactions?

To investigate the specific contributions of GYPC N-glycans to Plasmodium falciparum interactions, researchers can implement the following methodological approach:

  • Glycan structure characterization:

    • Sequential mass spectrometry to identify H2 antigen structures and polylactosamine structures capped with fucose

    • Glycan release and labeling followed by HPLC or capillary electrophoresis for quantitative analysis

  • Mutational analysis:

    • Site-directed mutagenesis of N-glycosylation sites to create glycosylation-deficient GYPC variants

    • Expression of these variants in appropriate systems that maintain proper folding

  • Binding and functional studies:

    • Surface plasmon resonance (SPR) to measure binding kinetics between EBA-140 and various GYPC glycoforms

    • Flow cytometry-based assays with fluorescently labeled parasites to assess invasion efficiency

    • Competition assays using isolated glycan structures to identify minimal binding determinants

  • Structural biology approaches:

    • X-ray crystallography or cryo-electron microscopy of EBA-140/GYPC complexes

    • Molecular dynamics simulations to understand the contribution of specific glycan structures to binding stability

These methodologies can help elucidate the precise role of different glycan structures in parasite recognition and potentially identify targets for therapeutic intervention in malaria.

What strategies can overcome the inherent instability of the GYPC gene during cloning procedures?

The GYPC gene contains two directly repeated domains of 3.4 kbp that make it prone to recombination events during cloning procedures, as evidenced by spontaneous deletions occurring during propagation in E. coli . To overcome these challenges, researchers should consider:

  • Specialized bacterial strains:

    • Use recombination-deficient E. coli strains (recA-) such as SURE or Stbl2

    • Employ strains specifically designed for unstable sequences, like CopyCutter EPI400

  • Modified cloning strategies:

    • Clone smaller fragments of GYPC separately to avoid including both repeated domains in a single construct

    • Consider using synthetic genes with modified codons that preserve amino acid sequence but reduce direct repeats

  • Alternative vector systems:

    • Use low-copy number vectors that reduce selective pressure for deletions

    • Consider BAC or PAC vectors which are better suited for maintaining large or unstable genomic fragments

  • Growth conditions optimization:

    • Reduce incubation temperature (30°C instead of 37°C)

    • Use rich media to minimize generation time and number of replications

  • Regular sequence verification:

    • Implement frequent restriction enzyme digestion screening to detect deletion events early

    • Use long-range PCR spanning the repeated regions to monitor integrity during propagation

These approaches can significantly reduce the frequency of spontaneous deletions and improve the stability of cloned GYPC constructs.

How can the glycosylation heterogeneity of recombinant GYPC be controlled in expression systems?

Controlling glycosylation patterns in recombinant GYPC is critical for ensuring consistency in structural and functional studies. The following methodological approaches can help manage glycosylation heterogeneity:

  • Expression system selection:

    • Mammalian cells (HEK293, CHO): Provide complex glycosylation patterns similar to native human cells

    • Insect cells (Sf9, High Five): Produce simpler, more homogeneous glycan structures

    • Prokaryotic systems (E. coli): Generate non-glycosylated protein that can be used for subsequent in vitro glycosylation

  • Cell culture optimization:

    • Control media composition, particularly nucleotide sugar precursors

    • Optimize culture pH and temperature, which can significantly affect glycosyltransferase activity

    • Implement fed-batch or perfusion culture methods to maintain consistent glycosylation conditions

  • Genetic engineering approaches:

    • Co-expression of specific glycosyltransferases to promote desired glycan structures

    • Knockout or knockdown of genes for undesired glycosyltransferases

    • Introduction of mutations at non-essential glycosylation sites to reduce heterogeneity

  • Post-expression processing:

    • Implement glycan remodeling using endo- and exo-glycosidases

    • Use lectin affinity chromatography to select for specific glycoforms

    • Apply chemoenzymatic methods to add defined glycan structures to minimally glycosylated cores

By applying these strategies systematically, researchers can generate more homogeneous recombinant GYPC preparations with defined glycosylation profiles suitable for structural and functional studies.

What emerging technologies might advance our understanding of GYPC structure-function relationships?

Several cutting-edge technologies are poised to significantly advance GYPC research:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of GYPC in membrane environments at near-atomic resolution

    • Can resolve glycan structures in context of the full protein

    • Allows for structural studies without crystallization, which is challenging for membrane glycoproteins

  • Glycoprotein-specific AlphaFold predictions:

    • Recent advances in AI protein structure prediction now better accommodate glycosylated proteins

    • Can provide insights into how glycans influence protein folding and stability

    • Useful for generating hypotheses about regions critical for parasite interactions

  • CRISPR-based genome editing in primary erythroid cells:

    • Allows for precise modification of GYPC in relevant cellular contexts

    • Can generate isogenic cell lines with specific GYPC variants

    • Enables functional studies in near-native environments

  • Single-molecule techniques:

    • Atomic force microscopy to measure GYPC-cytoskeleton interactions at the single-molecule level

    • Single-molecule FRET to analyze conformational changes during binding events

    • Optical tweezers to quantify forces involved in GYPC-mediated membrane stability

  • Glycomics integrated with proteomics:

    • Comprehensive analysis of site-specific glycosylation using advanced mass spectrometry

    • Identification of glycan microheterogeneity at individual attachment sites

    • Correlation of specific glycoforms with functional properties

These technologies will likely provide unprecedented insights into how GYPC structure, particularly its glycosylation pattern, determines its functional roles in erythrocyte stability and parasite invasion.

How might understanding GYPC variants inform development of malaria interventions?

The study of GYPC variants presents significant opportunities for developing novel malaria interventions:

  • Receptor-based intervention strategies:

    • Development of glycomimetics that compete with GYPC for EBA-140 binding

    • Design of antibodies targeting critical epitopes at the GYPC-EBA-140 interface

    • Creation of soluble GYPC decoys to divert merozoites from erythrocytes

  • Population genetics applications:

    • Identification of naturally occurring GYPC variants that confer malaria resistance

    • Genome-wide association studies correlating GYPC polymorphisms with clinical outcomes

    • Development of risk stratification models based on host GYPC genetics

  • Vaccine development approaches:

    • Design of immunogens presenting critical GYPC glycan epitopes

    • Multi-component vaccines targeting multiple receptor-ligand interactions

    • Induction of antibodies that block specific glycan-dependent binding events

  • Structural biology integration:

    • Structure-guided drug design targeting the GYPC-EBA-140 interface

    • Identification of allosteric sites that could modulate receptor binding

    • Computational screening of compound libraries against critical binding domains

Research into these approaches requires sophisticated methodologies including glycan array analysis, high-throughput parasite inhibition assays, and advanced structural biology techniques to resolve the molecular details of GYPC-parasite interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.