Recombinant Human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GPIHBP1; HBP1; Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-HBP1; GPI-anchored HDL-binding protein 1; High density lipoprotein-binding protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-184
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GPIHBP1
Target Protein Sequence
QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLT QNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPP WQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP
Uniprot No.

Target Background

Function
Recombinant Human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1) mediates the transport of lipoprotein lipase (LPL) from the basolateral to the apical surface of endothelial cells in capillaries. It anchors LPL to the luminal surface of capillary endothelial cells, protecting it from activity loss and ANGPTL4-mediated unfolding. This crucial role facilitates chylomicron lipolytic processing by LPL, influencing triglyceride metabolism and lipid homeostasis. GPIHBP1 also binds chylomicrons and phospholipid particles containing APOA5, and binds high-density lipoprotein (HDL), participating in lipid uptake from HDL.
Gene References Into Functions
  1. The negatively charged intrinsically disordered region (IDR) of GPIHBP1 spans a considerable distance, enabling LPL capture by capillary endothelial cells and contributing to GPIHBP1's LPL structure and activity preservation. PMID: 29899144
  2. Increased GPIHBP1 levels correlated significantly with decreased body weight. PMID: 29056530
  3. ApoC-III potently inhibits triglyceride hydrolysis when LPL is bound to GPIHBP1. PMID: 28694296
  4. Mutation of a conserved cysteine in GPIHBP1 abolishes its ability to bind LPL. PMID: 28476858
  5. One of 33 patients with unexplained chylomicronemia presented with GPIHBP1 autoantibody syndrome. PMID: 28666713
  6. Triglyceride-raising GPIHBP1 gene variants (encoding glycosylphosphatidylinositol-anchored HDL-binding protein 1) are associated with cardiovascular endpoints. PMID: 28534127
  7. ANGPTL4 inactivates LPL by catalyzing the unfolding of its hydrolase domain; GPIHBP1 binding renders LPL resistant to this inhibition; both the LU domain and the intrinsically disordered acidic domain of GPIHBP1 are necessary for this protective effect. PMID: 27929370
  8. Familial chylomicronemia is linked to GPIHBP1 gene mutations. PMID: 27578123
  9. mAbs RE3 and RG3 exhibited reduced affinity for a mutant GPIHBP1 (with Ly6 domain mutation W109S) that cannot bind LPL. Immunohistochemistry using GPIHBP1 mAbs revealed that human GPIHBP1 is expressed exclusively in capillary endothelial cells. An ELISA for detecting plasma GPIHBP1 was developed. PMID: 27875259
  10. Antibody 88B8 and GPIHBP1 binding to LPL relies on substantial portions of LPL's carboxyl-terminal domain. PMID: 27494936
  11. An LPL structural model suggests that the LPL S447X truncation exposes residues involved in LPL binding to lipoprotein binding uptake receptors, such as GPIHBP1. PMID: 27984852
  12. GPIHBP1's acidic domain stabilizes LPL catalytic activity by mitigating the global unfolding of LPL's catalytic domain. PMID: 26725083
  13. Two novel GPIHBP1 missense mutations were identified in unrelated patients with severe hypertriglyceridemia. PMID: 26892125
  14. GPIHBP1 mutations should be considered in neonates with chylomicronemia and no LPL gene mutations. PMID: 25911085
  15. GPIHBP1's two domains interact independently with LPL, and LPL functionality depends on its GPIHBP1 localization. PMID: 25873395
  16. No GPIHBP1 mutations were found in a cohort of patients with diabetic lipemia. PMID: 25131724
  17. A patient with type I hyperlipoproteinemia had homozygous mutations in a case series. PMID: 24793350
  18. GPIHBP1 missense mutations causing protein multimerization prevent lipoprotein lipase binding. PMID: 25387803
  19. Homozygosity for a deletion of exons 3 and 4 of GPIHBP1 results in Type 1 hyperlipoproteinemia. PMID: 24589565
  20. An extra cysteine in the GPIHBP1 Ly6 motif leads to GPIHBP1 multimerization, defective LPL binding, and severe hypertriglyceridemia. PMID: 24847059
  21. Wild-type and mutated (S447X-LPL) lipoprotein lipase (LPL) bind to GPIHBP1 with equal efficiency. PMID: 24704550
  22. A GPIHBP1 gene promoter polymorphism increased the risk of hypertriglyceridemia, additively impacting the risk conferred by defective LPL alleles. PMID: 21978733
  23. GPIHBP1 mutations are rare, but the associated hypertriglyceridemia is severe. PMID: 22239554
  24. Case report: Complete GPIHBP1 deficiency due to homozygous deletion of GPIHBP1. PMID: 22008945
  25. Glycosylphosphatidylinositol-anchored high-density lipoprotein binding protein 1 (GPIHBP1) expression was higher in young healthy subjects than in those with type 2 diabetes mellitus or controls. PMID: 22078753
  26. Function and genetics of GPIHBP1 in lipoprotein lipase transport. PMID: 21844202
  27. A mutation in the hydrophobic C-terminal domain impairs GPIHBP1 membrane targeting. PMID: 21816778
  28. GPIHBP1 is involved in triglyceride-rich lipoprotein catabolism and childhood-onset chylomicronemia. PMID: 21314738
  29. The Ly6 domain of GPIHBP1 is crucial for LPL binding and transport. PMID: 21478160
  30. Two LPL missense mutations (C418Y and E421K) abolish LPL binding to GPIHBP1 without affecting LPL catalytic activity or heparin binding. PMID: 21518912
  31. GPIHBP1 binds lipoprotein lipase, apoAV, and chylomicrons (via lipoprotein lipase), but not other lipase family members, apoAI, or high-density lipoprotein. PMID: 20966398
  32. Conserved cysteines in the Ly6 domain are essential for GPIHBP1 function. PMID: 20026666
  33. Observational study of gene-disease association. (HuGE Navigator) PMID: 20237496
  34. GPIHBP1 functions as an LPL stabilizer. PMID: 19542565
  35. A rare GPIHBP1 missense mutation is associated with severe hypertriglyceridemia and chylomicronemia. PMID: 17883852
  36. The G56R substitution did not affect GPIHBP1 cell surface expression or its binding to lipoprotein lipase, chylomicrons, or apo-AV. PMID: 17997385
  37. GPIHBP1's acidic domain is important, and electrostatic interactions are key for ligand binding. PMID: 18713736
  38. Case report: Chylomicronemia with a mutant GPIHBP1 (Q115P) that cannot bind lipoprotein lipase. PMID: 19304573
Database Links

HGNC: 24945

OMIM: 612757

KEGG: hsa:338328

STRING: 9606.ENSP00000329266

UniGene: Hs.426410

Involvement In Disease
Hyperlipoproteinemia 1D (HLPP1D)
Subcellular Location
Apical cell membrane; Lipid-anchor, GPI-anchor. Basolateral cell membrane; Lipid-anchor, GPI-anchor. Cell membrane; Lipid-anchor, GPI-anchor.

Q&A

What is the molecular structure of human GPIHBP1 and how does it relate to its function?

Human GPIHBP1 is synthesized as a 184-residue single-chain polypeptide that undergoes several post-translational modifications . The mature protein contains:

  • A highly negatively charged amino-terminal domain (with 17 of 25 consecutive residues being glutamate or aspartate)

  • A Ly-6 motif containing multiple cysteines that form five plesiotypical disulfide bonds (Cys35–Cys69, Cys48–Cys57, Cys63–Cys90, Cys94–Cys110, and Cys111–Cys116)

  • A folded LU domain (residues 42–109) that adopts a three-fingered fold with a cysteine-rich core projecting three long β-hairpins

  • A GPI anchor that attaches the protein to the cell membrane

These structural features enable GPIHBP1 to bind both LPL and chylomicrons, creating a platform for lipolytic processing at the capillary endothelium .

What post-translational modifications occur in GPIHBP1 and how can they be analyzed?

GPIHBP1 undergoes several critical post-translational modifications that influence its function:

  • Removal of N- and C-terminal signal peptides responsible for secretion and glycolipid anchoring

  • N-linked glycosylation of Asn58

  • O-sulfation of Tyr18

  • Formation of five disulfide bonds that define the LU domain

Methodological approach:
To analyze these modifications, researchers can employ mass spectrometry techniques including:

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for identification of glycosylation sites

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to analyze protein structure and dynamics

  • Site-directed mutagenesis to evaluate the functional significance of specific modifications

What is the tissue distribution pattern of GPIHBP1 and how does it correlate with LPL expression?

GPIHBP1 expression follows a specific pattern that largely mirrors LPL distribution:

TissueGPIHBP1 ExpressionLPL ExpressionNotes
HeartHighHighPerfect correlation
Adipose tissueHighHighPerfect correlation
Skeletal muscleHighHighPerfect correlation
LungsHighNegligibleEnigmatic mismatch
Blood vesselsCapillaries onlyN/AAbsent from venules, arterioles, and larger vessels

Methodological insight: When designing experiments to study GPIHBP1 function, tissue selection is critical. The lung presents an interesting research opportunity to investigate GPIHBP1 functions potentially independent of LPL processing .

How does GPIHBP1 transport LPL across endothelial cells and what experimental approaches can validate this mechanism?

GPIHBP1 "picks up" LPL from the interstitial spaces where it is secreted by adipocytes and myocytes, and shuttles it across endothelial cells to the capillary lumen . In the absence of GPIHBP1, LPL remains stranded in the interstitial spaces .

Experimental approaches to validate this transport mechanism include:

  • Immunofluorescence microscopy to track LPL localization in wild-type versus GPIHBP1-deficient tissues

  • Electron microscopy to visualize the distribution of LPL between the luminal and abluminal plasma membranes

  • Cell culture models with polarized endothelial cells expressing GPIHBP1 to study LPL trafficking

  • PIPLC treatment experiments to release GPI-anchored proteins and measure LPL release

The distribution analysis between wild-type and GPIHBP1-deficient models has shown that in normal tissues, LPL is evenly distributed between luminal and abluminal surfaces, while in knockout models, LPL never reaches the capillary lumen .

What is the binding mechanism between GPIHBP1 and LPL at the molecular level?

The binding between GPIHBP1 and LPL involves specific molecular interactions:

  • GPIHBP1's LU domain binds to LPL's PLAT domain along the entire concave face of GPIHBP1's central β-sheet

  • This interaction includes all three loops of the LU domain

  • The binding interface buries 940 Ų of GPIHBP1's surface

  • The binding is tight, with a calculated Kd = 3.6 × 10⁻⁸ M

  • The negatively charged domain of GPIHBP1 interacts with positively charged domains in LPL

  • Heparin can release LPL from GPIHBP1, suggesting potential competitive binding mechanisms

Research application: When designing mutations or synthetic peptides to inhibit or enhance GPIHBP1-LPL interactions, focus on the residues at this extensive interface rather than just isolated domains .

How does GPIHBP1 participate in lipoprotein margination along capillaries?

GPIHBP1 plays a crucial role in facilitating the interaction between lipoproteins and the capillary surface:

  • The GPIHBP1-LPL complex is anchored to the plasma membrane of endothelial cells

  • The luminal surface of endothelial cells is covered by an HSPG-rich glycocalyx

  • Electron microscopy has revealed that the glycocalyx is patchy, with tufts interrupted by "meadows" where the plasma membrane is exposed

  • Lipoproteins bind to capillaries within these gaps in the glycocalyx

  • GPIHBP1 binds chylomicrons directly, providing an additional mechanism for lipoprotein margination

Methodological consideration: When studying lipoprotein margination in vitro, researchers should consider the architectural complexity of the glycocalyx and incorporate elements that mimic this patchy distribution to better replicate in vivo conditions .

What are the specific GPIHBP1 mutations associated with hyperlipoproteinemia type 1D and their molecular consequences?

Several mutations in GPIHBP1 have been identified that cause hyperlipoproteinemia type 1D:

Mutation TypeMolecular ConsequenceDisease ManifestationReference
Homozygous variantsImpaired ability to bind LPLSevere hypertriglyceridemia
Compound heterozygosityReduced LPL binding capacityVariable hypertriglyceridemia
Mutations affecting LU domainCompromised binding interfaceChylomicronemia

The prevalence of hyperlipoproteinemia due to GPIHBP1 mutations is estimated between 1:500,000 to 1:1,000,000 .

Research insight: When screening for GPIHBP1 mutations in patients with unexplained hypertriglyceridemia, prioritize analysis of residues at the LPL binding interface, as these are most likely to cause disease when mutated .

What phenotypic characteristics are observed in GPIHBP1-deficient models and how do they compare to other causes of hypertriglyceridemia?

GPIHBP1-deficient models exhibit distinct phenotypic characteristics:

  • Severe chylomicronemia with plasma triglyceride levels as high as 5000 mg/dl

  • Milky plasma appearance even on a low-fat diet

  • Markedly delayed clearance of retinyl palmitate from plasma (>10-fold higher peak levels)

  • Persistence of high retinyl ester levels for 24 hours (compared to clearance within 10 hours in wild-type)

  • Increased plasma levels of apoB48

  • Fractionation reveals majority of triglycerides in large lipoproteins (chylomicron/VLDL peak)

Comparing to other hypertriglyceridemia causes:

Deficient ProteinMechanismPhenotype SeverityTreatment Response
GPIHBP1LPL mislocalizationSeverePoor response to conventional therapies
LPLEnzyme deficiencySeverePoor response to conventional therapies
APOC2LPL cofactor deficiencyVariableMay respond to plasma infusion
APOA5Altered chylomicron metabolismVariableVariable response
LMF1Impaired LPL maturationVariablePoor response to conventional therapies

Clinical research application: For pediatric patients with severe hypertriglyceridemia, combination treatment with fenofibrate and gemfibrozil has shown some efficacy in reducing triglyceride levels in GPIHBP1 deficiency .

What are the challenges in producing functional recombinant GPIHBP1 and how can they be overcome?

Producing functional recombinant GPIHBP1 presents several challenges:

  • Post-translational modification requirements: Recombinant GPIHBP1 must undergo correct glycosylation, sulfation, and disulfide bond formation

  • GPI-anchor complexity: The GPI anchor is essential for proper function but difficult to replicate in common expression systems

  • Conformational integrity: Maintaining the three-dimensional structure is crucial for LPL binding

Methodological solutions:

  • Use mammalian expression systems (CHO cells or HEK293) rather than bacterial systems to ensure proper post-translational modifications

  • For functional studies, construct a full-length mouse GPIHBP1 cDNA that can be transfected into cultured cells

  • Verify the GPI anchoring by PIPLC treatment, which should release the protein from the cell surface

  • Assess functionality through LPL binding assays and chylomicron binding experiments using fluorescently labeled lipoprotein particles (e.g., DiI-labeled chylomicrons)

How can researchers quantify GPIHBP1-LPL interactions and evaluate binding kinetics?

Several approaches can be employed to study GPIHBP1-LPL binding:

  • Cell-based binding assays:

    • Transfect cells (e.g., CHO ldlA7) with GPIHBP1 cDNA

    • Incubate with purified LPL

    • Measure bound LPL through various detection methods

    • Analyze binding saturation to calculate Kd (approximately 3.6 × 10⁻⁸ M)

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified GPIHBP1 on a sensor chip

    • Flow LPL over the surface at different concentrations

    • Measure real-time association and dissociation kinetics

  • Heparin competition assays:

    • Establish GPIHBP1-LPL binding

    • Add increasing concentrations of heparin

    • Measure LPL release to understand binding strength and competition mechanisms

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Identify binding interfaces and conformational changes upon binding

    • Validate findings from structural studies

    • Detect potential allosteric effects

What are the unresolved questions regarding GPIHBP1's role in lung tissue given the mismatch with LPL expression?

Despite significant advances in GPIHBP1 research, several questions remain unanswered:

  • Alternative functions in lungs: The high expression of GPIHBP1 in lungs where LPL expression is negligible suggests potential LPL-independent functions

  • Research approaches to explore this mystery:

    • Targeted lung-specific GPIHBP1 knockout models

    • Proteomic analysis to identify lung-specific GPIHBP1 binding partners

    • Transcriptomic studies comparing lung GPIHBP1 to GPIHBP1 in other tissues

    • Investigation of potential roles in pulmonary lipid homeostasis or immune function

  • Potential hypotheses to test:

    • GPIHBP1 may interact with other lipases or lipid transport proteins in lungs

    • It may serve as a binding site for circulating lipoproteins for purposes other than lipolysis

    • It could have immunological functions related to its membership in the Ly6 family of proteins

How might GPIHBP1 research inform the development of novel therapeutic approaches for hypertriglyceridemia?

Understanding GPIHBP1 biology opens several therapeutic avenues:

  • Gene therapy approaches:

    • Development of viral vectors for GPIHBP1 gene delivery to endothelial cells

    • CRISPR-based correction of GPIHBP1 mutations

  • Protein replacement strategies:

    • Engineering recombinant GPIHBP1 variants with enhanced stability

    • Development of fusion proteins that can bind to endothelial cells and restore LPL binding

  • Small molecule approaches:

    • Identification of compounds that could enhance residual GPIHBP1-LPL interactions

    • Development of molecules that could mimic GPIHBP1's LPL-stabilizing function

  • Clinical trials considerations:

    • Current trials are evaluating treatments for patients with familial chylomicronemia syndrome caused by mutations in GPIHBP1 and other genes (LPL, APOA5, APOC2, GPD1, LMF1)

    • Phase 3 studies are assessing novel approaches for this patient population

Research implication: When designing therapeutic strategies, consider that GPIHBP1 serves multiple functions: LPL transport, LPL stabilization, and direct chylomicron binding. The ideal therapeutic would address all these aspects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.