Recombinant Human GPS, PLAT and transmembrane domain-containing protein FLJ00285

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format readily available in our inventory. However, if you have specific format preferences, please indicate your requirement in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for extended storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Minimize freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize development of the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-789
Protein Length
full length protein
Target Protein Sequence
MAFQTQAGAQIPIERLASERAITVKVPNNSDWAARGHRSSANSVVVQPQASVGAVVTLDS SNPAAVLHLQLNYTLLDGRYLSEEPEPYLAVYLHSEPRPNEHNCSASRRIRPESLQGADH RPYTFFISPGTRDPVGSYRLNLSSHFRLSALEVSVGLYTSLCQYFSEEDVVWRTEGLLPL EETSPRQAVCLTRHLTAFGASLFVPPSHVRFVFPEPTADVNYIVMLTCAVCLVTYMVMAA ILHKLDQLDASRGRAIPFCGQRGRFKYEILVKTGWGRGSGTTAHVGIMLYGVDSRSGHRH LDGDRAFHRNSLDIFRIATPHSLGSVWKIRVWHDKGLSPAWFLQHVIIRDLQTAHSTFFL VNDWLSVETEANGGLVEKEVLAASHAALLRFRRLLVAELQCGFFDKHIWLSIWDRPPRSC FTRIQRATCCVLLICLFLGANAVWYGAVGDSAYSTGHVSRLSPLSVDTVAVGLVSSVVVY PVYLAILFLFWMSRSKVAGSPSPTPAGQQVLDIDSCLDSSVLDSSFLTFSGLHAEVINTL ADHRHRGTDFGGSPWLLIITVFLRSYKFAISLCTTYLWVINTLADHRHRGTDFGGSPWLL IITVFLRSYKFAISLCTTYLCVSFLKTIFPSQNGHDGSTDVQQRARRSNRRRQEGIKIVL EDIFTLWRQVETKVRAKIRKMKVTTKVNRHDKINGKRKTAKEHLRKLSMKEREHGEKERQ VSEAEENGKLDMKEIHTYMEMFQRAQALRRRAEDYYRCKITPSARKPLCNRCTYNLVLPG SEKKYYSHA
Uniprot No.

Q&A

How should recombinant FLJ00285 be stored and handled for optimal stability?

For optimal stability in experimental settings, recombinant GPS, PLAT and transmembrane domain-containing protein FLJ00285 should be stored at -20°C for regular use, and at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein .

Methodological recommendations for handling include:

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Prepare working aliquots upon initial thawing

  • Store working aliquots at 4°C for up to one week only

  • When using in experiments, maintain on ice when possible and minimize time at room temperature

What expression systems are most effective for producing functional recombinant FLJ00285?

Based on current research protocols, E. coli has been successfully employed as an expression system for producing recombinant human GPS, PLAT and transmembrane domain-containing protein FLJ00285 . The protein is typically expressed with an N-terminal His-tag to facilitate purification.

For researchers seeking to optimize expression, consider the following methodological approaches:

  • Bacterial expression: E. coli systems are effective for producing the full-length protein with appropriate tags

  • Protein tagging: His-tagging at the N-terminus has been validated for purification while maintaining protein structure

  • Expression region: The entire protein sequence (amino acids 1-789) has been successfully expressed in these systems

When designing expression constructs, researchers should consider that transmembrane proteins may require specialized conditions for proper folding and functionality.

What are the preliminary known biological functions of FLJ00285?

While comprehensive functional studies of FLJ00285 are still emerging, insights can be drawn from research on related transmembrane domain-containing proteins. The protein likely serves multiple functions based on its domain architecture:

  • Membrane localization: The transmembrane domain suggests the protein is anchored in cellular membranes, potentially playing a role in cell signaling or membrane organization

  • Potential signaling role: The presence of GPS and PLAT domains suggests involvement in signaling pathways

Research on analogous proteins with transmembrane domains, such as Pyramus (Pyr), indicates that the transmembrane domain may promote spatial precision in paracrine activation of receptors and that the intracellular portion can limit protein levels .

How might the transmembrane domain of FLJ00285 contribute to its cellular localization and signaling functions?

The transmembrane domain of FLJ00285 likely plays a crucial role in both its cellular localization and signaling precision. Research on related transmembrane-containing proteins provides valuable insights into potential mechanisms.

Studies on the Pyramus protein, which contains a comparable transmembrane domain, demonstrate that this structure significantly influences:

  • Localized signaling: The transmembrane domain promotes spatial precision in paracrine activation of receptors, restricting signaling to specific cellular regions

  • Receptor enrichment: Transmembrane domains contribute to the concentration of receptors at tissue interfaces, enhancing signaling efficiency

  • Protrusion formation: Transmembrane-anchored signaling proteins can influence cell morphology by regulating protrusion formation

Methodologically, researchers investigating these functions in FLJ00285 should consider:

  • Live imaging of fluorescently tagged constructs in appropriate cell lines

  • Comparing localization patterns of full-length versus transmembrane domain-deleted variants

  • Examining receptor clustering in the presence of intact or modified FLJ00285

What experimental approaches are recommended for studying protein-protein interactions involving FLJ00285?

To investigate the protein-protein interactions of FLJ00285, researchers should employ multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): This classic approach can identify stable protein interactions. Use anti-tag antibodies (e.g., anti-His) to pull down recombinant FLJ00285 and identify binding partners.

  • Yeast two-hybrid screening: Though challenging with transmembrane proteins, modified membrane yeast two-hybrid systems can be employed to identify potential interactors.

  • Proximity labeling approaches: BioID or TurboID fusion proteins can identify proteins in close proximity to FLJ00285 in living cells.

  • Surface plasmon resonance: To quantify binding kinetics between FLJ00285 and candidate partners.

  • Cross-linking mass spectrometry: To capture transient interactions and determine interaction interfaces.

Data from studies of related proteins suggest that FLJ00285 may interact with specific proteins in signaling pathways, potentially including receptors or other membrane-associated proteins .

How can researchers effectively validate the activity of recombinant FLJ00285?

Validating the biological activity of recombinant FLJ00285 requires multiple approaches:

  • Structural integrity assessment:

    • Circular dichroism to confirm proper secondary structure

    • Limited proteolysis to verify domain folding

    • Size exclusion chromatography to ensure proper oligomeric state

  • Functional assays:

    • Membrane integration analysis in reconstituted systems

    • Ligand binding assays if receptor interactions are suspected

    • Phosphorylation state analysis if involved in signaling cascades

  • Cellular response monitoring:

    • Analysis of downstream pathway activation (e.g., MAPK signaling)

    • Cell morphology changes upon addition of purified protein

    • Receptor clustering or redistribution observations

Research on related transmembrane proteins suggests monitoring effects on protrusion formation and receptor localization as potential readouts for FLJ00285 activity .

What are the key considerations for designing domain deletion experiments with FLJ00285?

Domain deletion experiments are crucial for understanding the function of multi-domain proteins like FLJ00285. Based on research with similar proteins, consider the following methodological approaches:

  • Strategic boundary selection:

    • Carefully select domain boundaries based on structural predictions

    • Preserve secondary structure elements to prevent misfolding

    • Consider using the established boundaries at amino acids 399-400 and 425-426 for transmembrane domain studies

  • Comparative analysis:

    • Generate constructs lacking specific domains (GPS, PLAT, or transmembrane)

    • Create truncation mutants similar to those described for Pyramus (e.g., 1-399, 1-440)

    • Analyze cellular localization, protein stability, and functional outcomes for each variant

  • Assay selection:

    • Membrane localization assays to assess transmembrane domain function

    • Protein stability measurements to identify potential degron regions

    • Cell shape and receptor distribution analysis to assess functional consequences

Research on Pyramus shows that removal of the C-terminal degron while preserving the transmembrane domain can result in increased protein levels and ectopic signaling activation, suggesting similar regulatory mechanisms may exist in FLJ00285 .

How might post-translational modifications affect FLJ00285 function?

Post-translational modifications (PTMs) likely play important roles in regulating FLJ00285 function. While specific PTMs for this protein are not yet fully characterized, several approaches can be employed to investigate them:

  • Identification of potential modification sites:

    • Phosphorylation site prediction tools indicate several potential sites in the intracellular domain

    • Glycosylation may occur in the extracellular regions

    • Ubiquitination sites may be present, particularly if the protein contains a degron region similar to Pyramus

  • Experimental verification:

    • Mass spectrometry analysis of purified protein to identify modifications

    • Site-directed mutagenesis of predicted modification sites

    • Immunoblotting with modification-specific antibodies

  • Functional consequences:

    • Analysis of protein stability upon inhibition of modification pathways

    • Examination of localization changes when modifications are blocked

    • Assessment of signaling capacity when modification sites are mutated

Research on related proteins suggests that degron regions can regulate protein levels and signaling precision, indicating that ubiquitination may be a key regulatory mechanism for FLJ00285 .

What analytical techniques are most informative for characterizing the structural properties of FLJ00285?

For comprehensive structural characterization of FLJ00285, researchers should consider a multi-technique approach:

When analyzing transmembrane domains specifically, researchers should employ specialized techniques such as solid-state NMR or oriented circular dichroism to determine transmembrane helix tilt angles and membrane insertion depth.

How can CRISPR-Cas9 gene editing be applied to study FLJ00285 function in cellular systems?

CRISPR-Cas9 gene editing offers powerful approaches for investigating FLJ00285 function:

  • Knockout strategies:

    • Complete gene knockout to assess loss-of-function phenotypes

    • Domain-specific deletions by targeting exons encoding specific domains

    • Introduction of early stop codons to mimic truncation mutants

  • Knock-in approaches:

    • Endogenous tagging with fluorescent proteins or epitope tags

    • Introduction of specific mutations to assess functional consequences

    • Domain swapping with related proteins to assess domain-specific functions

  • Regulatory element editing:

    • Promoter modifications to alter expression levels

    • Enhancer targeting to study tissue-specific expression

    • UTR modifications to investigate post-transcriptional regulation

  • Experimental design considerations:

    • Use multiple guide RNAs to ensure complete knockout

    • Validate edits by sequencing and protein expression analysis

    • Include rescue experiments with wild-type and mutant constructs

For studying transmembrane domain functions specifically, researchers could generate cell lines with domain deletions similar to those described for Pyramus (e.g., deletion of amino acids 400-425) .

What are the challenges and solutions for expressing full-length versus truncated versions of FLJ00285?

Expression of transmembrane proteins presents unique challenges that require specific strategies:

ChallengeFull-Length ProteinTruncated VersionsSolutions
Protein solubilityLow due to hydrophobic transmembrane domainPotentially higher depending on domains retainedUse detergents, nanodiscs, or amphipols for full-length; optimize buffer conditions for truncated versions
Expression yieldTypically lowerGenerally higherUse specialized expression strains; optimize codon usage; consider insect or mammalian cells for complex proteins
Proper foldingMore challengingDomain-dependentInclude molecular chaperones; lower expression temperature; use fusion partners
Purification complexityHigherLowerTwo-step purification strategies; on-column detergent exchange; size exclusion chromatography
Functional assessmentRequires membrane reconstitutionDomain-specific assaysLiposome reconstitution for full-length; domain-specific activity assays for truncated versions

Current successful expression of FLJ00285 has been achieved in E. coli with N-terminal His-tagging , but researchers should consider that mammalian expression systems might yield protein with more native post-translational modifications.

How might understanding FLJ00285 function contribute to disease research?

While specific disease associations for FLJ00285 are not yet well established, research on transmembrane domain-containing proteins offers insights into potential applications:

  • Cell signaling disorders:

    • The presence of GPS and PLAT domains suggests involvement in signaling pathways

    • Aberrant signaling is implicated in numerous diseases including cancer and developmental disorders

    • Studying FLJ00285's role in receptor localization could reveal new disease mechanisms

  • Developmental biology applications:

    • Research on related proteins like Pyramus demonstrates roles in cell migration and tissue patterning

    • FLJ00285 may similarly influence cell polarity, protrusion formation, or tissue organization

    • These processes are frequently dysregulated in developmental disorders

  • Research methodology:

    • Generate conditional knockout mouse models

    • Utilize patient-derived cells with potential mutations

    • Employ high-throughput screening to identify small molecule modulators

What are the emerging technologies that could advance FLJ00285 research?

Several cutting-edge technologies hold promise for advancing our understanding of FLJ00285:

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell types expressing FLJ00285

    • Single-cell proteomics to measure protein levels in different cellular contexts

    • Spatial transcriptomics to map expression patterns in tissues

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize nanoscale distribution

    • FRET-based sensors to monitor protein interactions in real-time

    • Light-sheet microscopy for whole-tissue imaging of protein dynamics

  • Functional genomics platforms:

    • CRISPR screening to identify genetic interactions

    • Proteome-wide interaction mapping using proximity labeling

    • Synthetic biology approaches to reconstitute signaling pathways

  • Computational methods:

    • Deep learning for predicting protein-protein interactions

    • Systems biology modeling of signaling networks

    • Integrative multi-omics analysis to place FLJ00285 in broader biological contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.