Recombinant Human GRAM domain-containing protein 1B (GRAMD1B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
GRAMD1B; KIAA1201; UNQ3032/PRO9834; Protein Aster-B; GRAM domain-containing protein 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-738
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GRAMD1B
Target Protein Sequence
MKGFKLSCTASNSNRSTPACSPILRKRSRSPTPQNQDGDTMVEKGSDHSSDKSPSTPEQG VQRSCSSQSGRSGGKNSKKSQSWYNVLSPTYKQRNEDFRKLFKQLPDTERLIVDYSCALQ RDILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTDSEK HFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDD DFNTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFD GLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPTELSDSSDTHD EGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEE NGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYT INRYTLTRVARNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESELAKTES TYLAEMHRQSPKEKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAG STQTRHIPEDTPNGFHLQSVSKLLLVISCVICFSLVLLVILNMMLFYKLWMLEYTTQTLT AWQGLRLQERLPQSQTEWAQLLESQQKYHDTELQKWREIIKSSVMLLDQMKDSLINLQNG IRSRDYTSESEEKRNRYH
Uniprot No.

Target Background

Function

GRAMD1B is a cholesterol transporter mediating non-vesicular cholesterol transfer from the plasma membrane (PM) to the endoplasmic reticulum (ER). Its unique cholesterol- and PM-binding domains act as a molecular bridge facilitating this transfer. GRAMD1B plays a critical role in adrenal gland cholesterol homeostasis. Its PM localization is dynamically regulated by membrane cholesterol levels; under lipid-poor conditions, it resides in the ER membrane, while excess PM cholesterol recruits it to endoplasmic reticulum-plasma membrane contact sites (EPCS) via its GRAM domain. At the EPCS, its sterol-binding VASt/ASTER domain binds PM cholesterol, enabling its transfer to the ER.

Database Links

HGNC: 29214

KEGG: hsa:57476

STRING: 9606.ENSP00000436500

UniGene: Hs.144725

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cell membrane; Single-pass membrane protein.

Q&A

What is GRAMD1B and what are its primary functions?

GRAMD1B is a cholesterol transporter that mediates non-vesicular transport of cholesterol from the plasma membrane (PM) to the endoplasmic reticulum (ER) . It contains unique domains for binding cholesterol and the plasma membrane, serving as a molecular bridge for cholesterol transfer between these cellular compartments . The protein plays a crucial role in cholesterol homeostasis, particularly in the adrenal gland, and has the ability to localize to the plasma membrane based on membrane cholesterol levels .

Beyond cholesterol transport, GRAMD1B functions as a key signaling molecule that inhibits cell migration in breast cancer by negating both JAK/STAT and Akt signaling pathways . This dual role in lipid transport and signaling makes GRAMD1B particularly interesting for researchers studying cellular homeostasis mechanisms. The protein is also implicated in modulating inflammatory responses, as it is expressed in various cell types including astrocytes, microglia, neurons, peripheral monocytes, and macrophages .

How is GRAMD1B structurally organized?

GRAMD1B belongs to the GRAMD family of proteins (GRAMD1a, GRAMD1b, GRAMD1c, GRAMD2, and GRAMD3) that all possess an N-terminal GRAM domain and a C-terminal transmembrane domain . The structural organization of GRAMD1B includes several functional domains that contribute to its biological activities:

  • An N-terminal GRAM domain involved in membrane association

  • A StART-like domain (also called VASt/ASTER domain) that binds to cholesterol and facilitates its transfer

  • A C-terminal transmembrane domain that anchors the protein to the ER membrane

  • A luminal helix that mediates protein-protein interactions through its hydrophobic surface

Secondary structure predictions indicate the presence of a conserved alpha helix within the luminal region of GRAMD1s, with GRAMD1B containing an amphipathic helix where charged and hydrophobic amino acids occupy opposite sides . This amphipathic helix is critical for the formation of homo- and heteromeric complexes with other GRAMD proteins . Experimental evidence shows that mutations in this region disrupt GRAMD1B's ability to form discrete patches on the ER membrane and to interact with other GRAMD proteins .

Where is GRAMD1B expressed in human tissues?

GRAMD1B shows a diverse expression pattern across multiple tissues and cell types. In the central nervous system (CNS), it is expressed in microglia, neurons, and astrocytes . This expression pattern is consistent with its potential role in neurological disorders such as multiple sclerosis. Notably, GRAMD1B is expressed by vessel-associated astrocytes in brain tissue, and its expression is downregulated in active multiple sclerosis lesions in autopsied brains .

Outside the CNS, GRAMD1B is expressed in peripheral monocytes and macrophages, suggesting a role in immune function and inflammatory responses . Immunohistochemistry studies have shown GRAMD1B positivity in the nucleus and nucleoli of the human cell line U-2 OS and in paraffin-embedded human gall bladder tissue .

GRAMD1B plays a particularly crucial role in cholesterol homeostasis in the adrenal gland , suggesting tissue-specific functions related to steroid hormone production. This diverse expression pattern across multiple tissues indicates that GRAMD1B may have context-specific functions depending on the cellular environment and tissue type.

How does GRAMD1B contribute to cholesterol transport?

GRAMD1B mediates non-vesicular transport of cholesterol from the plasma membrane (PM) to the endoplasmic reticulum (ER) through a well-coordinated mechanism . It functions as a molecular bridge by containing unique domains for binding both cholesterol and the plasma membrane .

The mechanism of GRAMD1B-mediated cholesterol transport follows several steps:

  • In lipid-poor conditions, GRAMD1B localizes to the ER membrane

  • When excess cholesterol accumulates in the PM, GRAMD1B is recruited to the endoplasmic reticulum-plasma membrane contact sites (EPCS)

  • This recruitment is specifically mediated by the GRAM domain

  • At the EPCS, the sterol-binding VASt/ASTER domain of GRAMD1B binds to cholesterol in the PM

  • GRAMD1B then facilitates the transfer of cholesterol from the PM to the ER

This process represents an essential homeostatic mechanism that maintains appropriate cholesterol levels in cellular membranes. GRAMD1B and other GRAMD1 proteins move to ER-PM contact sites upon acute expansion of the accessible pool of PM cholesterol, contributing to extracting accessible PM cholesterol to maintain proper membrane composition and function .

What mechanisms regulate GRAMD1B localization in response to cholesterol levels?

This recruitment process is mediated by the GRAM domain of GRAMD1B, which functions as a cholesterol sensor . The domain's ability to detect changes in membrane cholesterol concentration allows for rapid translocation of GRAMD1B to sites where cholesterol transport is needed. Experimental evidence demonstrates that GRAMD1s move to ER-PM contact sites upon acute expansion of the accessible pool of PM cholesterol .

The sterol-binding VASt/ASTER domain also plays a crucial role in this process, as it specifically binds to cholesterol in the PM at contact sites . This domain's ability to recognize and bind cholesterol is essential for the subsequent transfer of cholesterol from the PM to the ER. The coordination between the GRAM domain's sensing function and the VASt/ASTER domain's binding capacity enables GRAMD1B to respond efficiently to changes in cellular cholesterol distribution.

How do GRAMD1B complexes form and what is their functional significance?

GRAMD1B forms both homo- and heteromeric complexes with other GRAMD proteins, observed as discrete patches along ER tubules when visualized using fluorescent protein tags and high-resolution microscopy . These complexes are not randomly distributed but form organized structures with specific compositional properties.

The formation of these complexes involves key structural elements:

  • A conserved amphipathic helix within the luminal region, where charged and hydrophobic amino acids occupy opposite sides of the helix

  • The transmembrane domain, which contributes to proper membrane anchoring and organization

Experimental evidence demonstrates that removing the luminal helix (Δhelix) or mutating five hydrophobic residues within it to glutamic acid (5E) disrupts the formation of discrete patches on tubular ER and reduces both homomeric interactions between GRAMD1Bs and heteromeric interactions between GRAMD1B and GRAMD1a . Furthermore, replacing the transmembrane domain and luminal region of GRAMD1B with those from Sec61β (TM swap) completely abolishes its ability to form these protein complexes .

The functional significance of these complexes appears related to the coordinated sensing and transport of cholesterol at ER-PM contact sites. By forming specialized domains along the ER that facilitate interaction with the plasma membrane, these complexes may enhance the efficiency of cholesterol transport and provide a mechanism for rapid response to changes in membrane cholesterol levels.

What is the relationship between GRAMD1B and multiple sclerosis?

Multiple sclerosis (MS) is a chronic inflammatory disease of the central nervous system, and emerging evidence suggests GRAMD1B may play a role in its pathophysiology . A comprehensive whole-genome sequencing study identified several connections between GRAMD1B and MS:

  • A GRAMD1B gene variant was found to be shared among MS cases and resided under a linkage peak (LOD: 2.194)

  • Sequencing of GRAMD1B in 91 familial MS cases revealed additional rare missense and splice-site variants

  • Two of these variants (rs755488531 and rs769527838) were not found in 1000 Italian healthy controls

  • Burden tests comparing rare, non-synonymous, and splice-site variants within the GRAMD1B coding region showed significant differences between familial MS patients and healthy controls

At the functional level, GRAMD1B was found to be downregulated in vessel-associated astrocytes of active MS lesions in autopsied brains . This finding is particularly notable as astrocytes play critical roles in blood-brain barrier function and neuroinflammation. Additionally, inflammatory stimuli were shown to downregulate GRAMD1B expression in peripheral monocytes , suggesting that inflammation-induced changes in GRAMD1B levels may contribute to disease processes.

These findings collectively suggest that GRAMD1B may function in modulating inflammatory responses and disease pathophysiology in MS, potentially through its roles in cholesterol homeostasis, membrane organization, or signaling pathway regulation.

How does GRAMD1B regulate cell migration in breast cancer?

GRAMD1B functions as a regulator of cell migration in breast cancer cells, with evidence indicating it acts as an inhibitor of migratory behavior . Research has uncovered several mechanisms through which GRAMD1B influences cancer cell motility:

  • GRAMD1B knockdown causes distinctive morphological changes characterized by the formation of membrane ruffling and protrusions, features associated with enhanced migratory capacity

  • Inhibition of GRAMD1B significantly enhances cell migration, accompanied by increased levels of the Rho family of GTPases, which are known regulators of cytoskeletal dynamics and cell movement

  • The pro-migratory phenotype associated with GRAMD1B knockdown is linked to activation of both JAK2/STAT3 and Akt signaling pathways

  • Pharmacological inhibition of either JAK2 or Akt efficiently suppresses the enhanced migration phenotype caused by GRAMD1B knockdown

These findings demonstrate that GRAMD1B normally functions to inhibit cell migration in breast cancer by negating both JAK/STAT and Akt signaling . The inverse relationship between GRAMD1B expression and migratory capacity suggests that loss of GRAMD1B function may contribute to cancer progression by promoting cell motility, a critical step in metastasis.

This research provides a foundation for potentially developing GRAMD1B as a novel biomarker in breast cancer and highlights its role as a negative regulator of cancer cell migration through specific signaling pathway interactions.

What signaling pathways are modulated by GRAMD1B?

GRAMD1B modulates several important signaling pathways, particularly in contexts of cell migration and inflammatory responses:

  • JAK/STAT Signaling:

    • GRAMD1B knockdown leads to JAK2/STAT3 activation

    • JAK2 inhibition using AG490 efficiently suppresses the enhanced migration caused by GRAMD1B knockdown

    • This suggests GRAMD1B normally functions to restrain JAK/STAT signaling

  • Akt Signaling:

    • GRAMD1B knockdown results in Akt activation

    • Akt inhibition suppresses the pro-migratory phenotype caused by GRAMD1B knockdown

    • Interestingly, AG490 (a JAK2 inhibitor) dose-dependently increases p-Akt levels, suggesting complex cross-talk between these pathways

  • Rho GTPase Signaling:

    • GRAMD1B inhibition is associated with increased levels of the Rho family of GTPases

    • These changes likely contribute to the cytoskeletal remodeling and enhanced cell migration observed with GRAMD1B knockdown

  • Inflammatory Pathways:

    • GRAMD1B is downregulated by inflammatory stimuli in peripheral monocytes

    • This suggests GRAMD1B may function as a negative regulator of inflammatory responses, potentially relevant to its role in multiple sclerosis

Epistasis analysis suggests that JAK/STAT inhibition affects p-Akt levels through the regulation of GRAMD1B expression , indicating a feedback mechanism between these signaling cascades. These findings position GRAMD1B as a key signaling molecule at the intersection of multiple pathways regulating cell behavior and inflammatory responses, with important implications for both normal physiology and disease states.

What are the optimal approaches for studying GRAMD1B expression?

Several methodological approaches have been successfully employed to study GRAMD1B expression across different experimental systems:

  • Quantitative RT-PCR (qRT-PCR):

    • RNA isolation can be performed using TRIzol (Sigma-Aldrich)

    • For rat studies, primers specific to rGRAMD1B, rRpI18S, and rFrataxin have been validated

    • This method allows for relative quantification of GRAMD1B expression across different tissues or experimental conditions

    • RNA quality and quantity assessment is critical for reliable results

  • Immunofluorescence and Immunohistochemistry:

    • Anti-GRAMD1B antibodies (such as rabbit polyclonal ab121286) have been validated for immunohistochemistry in paraffin-embedded tissues (IHC-P) and immunocytochemistry/immunofluorescence (ICC/IF)

    • For immunofluorescence, cells can be fixed with cold methanol for 10 minutes, blocked with 5% horse serum/0.1% Triton X-100 in PBS for 60 minutes, and labeled with primary antibody overnight at 4°C

    • Secondary antibody labeling is typically performed for 1 hour, followed by nuclear staining with Hoechst 33,342

    • Visualization can be achieved using confocal microscopy, such as Leica TCS SP8 with a 63× objective

  • Western Blotting:

    • Western blotting provides quantitative assessment of GRAMD1B protein levels

    • This technique has been used to confirm GRAMD1B expression and validate knockout models

    • Standard protocols for membrane protein extraction and SDS-PAGE separation can be applied

  • Fluorescent Protein Tagging and Live Cell Imaging:

    • GRAMD1B can be tagged with fluorescent proteins (EGFP, mRuby, mCherry) for visualization in live cells

    • High-resolution imaging techniques like spinning disc confocal microscopy coupled with structured illumination (SDC-SIM) enable analysis of GRAMD1B localization and dynamics

    • This approach allows for temporal monitoring of GRAMD1B redistribution in response to stimuli like changes in cholesterol levels

When studying GRAMD1B expression in different cell types, it's important to consider that it is expressed in various cells including astrocytes, microglia, neurons, peripheral monocytes, and macrophages , which may require specialized isolation and culture protocols for optimal results.

How can GRAMD1B function be assessed in experimental models?

Multiple experimental approaches have been developed to assess GRAMD1B function in various research contexts:

  • Gene Knockdown and Knockout:

    • The CRISPR/Cas9 system has been successfully used to disrupt GRAMD1 function by targeting specific exons encoding the lipid-harboring StART-like domains

    • Guide RNAs specific to exon 13 of GRAMD1A and GRAMD1B and to exon 11 of GRAMD1C have proven effective

    • Validation of knockout requires thorough characterization by western blotting and genomic sequencing

    • Both single-gene knockouts and multiple-gene knockouts (DKO and TKO) can be generated to address potential functional redundancy

  • Plasmid-Based Expression Systems:

    • Full-length GRAMD1B can be cloned from commercial sources (e.g., Origene clone SC316068, GenBank accession number NM_020716.2)

    • PCR amplification using specific primers (e.g., 3′-BamHI-GRAMD1B_Fw and 5′-Xho-GRAMD1B_Rev) enables subcloning into expression vectors

    • Transfection into cell lines can be performed using reagents like Lipofectamine 2000 following manufacturer protocols

    • Expression should be confirmed by immunofluorescence or western blotting

  • Mutagenesis Studies:

    • Site-directed mutagenesis can create specific variants of GRAMD1B to study structure-function relationships

    • Key variants include removing the luminal helix (Δhelix), mutating hydrophobic residues to glutamic acid (5E), or domain-swapping experiments (TM swap)

    • These modified constructs provide valuable insights into the structural determinants of GRAMD1B function

  • Cell Migration Assays:

    • Given GRAMD1B's role in regulating cell migration, wound healing or transwell migration assays provide functional readouts

    • Changes in the Rho family of GTPases can be measured as downstream markers of GRAMD1B modulation

    • Time-lapse microscopy enables quantitative assessment of migration parameters

  • Signaling Pathway Analysis:

    • Western blotting for phosphorylated JAK2/STAT3 and Akt assesses GRAMD1B's impact on these signaling pathways

    • Pathway inhibitors like AG490 (JAK2 inhibitor) can be used in epistasis experiments to establish hierarchical relationships

    • Phosphoproteomic approaches may identify additional signaling targets

What genetic tools are available for GRAMD1B manipulation?

Several genetic tools have been developed and validated for manipulating GRAMD1B expression and function:

  • CRISPR/Cas9 Genome Editing:

    • Guide RNAs targeting specific exons of GRAMD1B have been designed and validated for efficient gene disruption

    • Guide RNAs targeting exon 13 of GRAMD1B, which encodes the lipid-harboring StART-like domain, have been successfully employed

    • This approach has generated both GRAMD1a/1b double knockout (DKO) and GRAMD1a/1b/1c triple knockout (TKO) cell lines

    • Genomic sequencing confirms the precise mutations introduced at the target sites

  • Expression Plasmids:

    • Plasmids encoding EGFP-tagged human GRAMD1B wild-type (EGFP-GRAMD1Bwt) have been generated using full-length clones

    • The BamHI/XhoI sites of pEGFP-N1 vector have been used for subcloning GRAMD1B, resulting in constructs like pEGFP-N1-GRAMD1B

    • These constructs enable overexpression studies, rescue experiments, and localization analysis

  • Mutation Constructs:

    • Several mutant versions of GRAMD1B have been created to study specific domains:

      • GRAMD1b (Δhelix): lacking the luminal helix important for protein-protein interactions

      • GRAMD1b (5E): with five hydrophobic residues within the luminal helix mutated to glutamic acid, disrupting the hydrophobic surface

      • GRAMD1b (4E): with four hydrophobic residues preceding the luminal helix mutated to glutamic acid

      • GRAMD1b (TM swap): with the transmembrane domain and luminal region replaced with those from Sec61β

  • Primers for PCR and Sequencing:

    • Primers for amplifying and sequencing GRAMD1B have been designed using tools like Primer 3

    • Primers with amplicons ranging from 150 to 349 bp have been validated for sequencing GRAMD1B variants in patients

    • These primers can be validated both in silico and experimentally before application

  • TaqMan Probes:

    • TaqMan probes have been developed for genotyping GRAMD1B variants in case-control studies

    • These probes enable high-throughput screening for specific variants in large population samples

These genetic tools provide researchers with diverse options for manipulating GRAMD1B expression and function, allowing for detailed investigation of its role in cellular processes and disease mechanisms.

What are the challenges in studying GRAMD1B interactions with other proteins?

Investigating GRAMD1B interactions with other proteins presents several significant challenges that researchers should consider in experimental design:

  • Complex Formation Dynamics:

    • GRAMD1B forms both homo- and heteromeric complexes with other GRAMD proteins, creating a complex network of interactions

    • The composition of these complexes may vary depending on cellular conditions and cholesterol levels

    • The transient nature of some interactions, particularly at ER-PM contact sites that form in response to changing lipid composition, makes them difficult to capture with standard techniques

    • The dynamic redistribution of GRAMD1B between different cellular compartments further complicates interaction studies

  • Structural Constraints:

    • GRAMD1B is a membrane-associated protein with transmembrane domains, making it challenging to express and purify for in vitro interaction studies

    • The amphipathic helices involved in protein-protein interactions are located in the luminal region, which may adopt different conformations depending on the lipid environment

    • Traditional protein-protein interaction assays may not faithfully reproduce the membrane environment necessary for physiologically relevant interactions

  • Functional Redundancy:

    • The GRAMD family includes multiple members with potentially overlapping functions

    • Knockout studies have shown that cells lacking GRAMD1a/1b or even GRAMD1a/1b/1c remain viable with no obvious morphological defects

    • This redundancy may mask the effects of manipulating a single family member, requiring multiple knockouts to reveal functional interactions

  • Context-Dependent Interactions:

    • GRAMD1B's interactions likely vary depending on cell type and physiological context

    • Its expression in diverse cell types including astrocytes, microglia, neurons, and immune cells suggests context-specific interaction partners

    • Disease states like multiple sclerosis or cancer may alter the interaction landscape through changes in expression or localization

To address these challenges, researchers should consider complementary approaches such as proximity labeling techniques (BioID, APEX), in situ techniques that preserve cellular architecture, and systems biology approaches that can capture the complexity of interaction networks in different cellular contexts.

How might GRAMD1B be targeted for therapeutic development?

Based on current understanding of GRAMD1B functions, several therapeutic strategies could be considered for targeting this protein in disease contexts:

  • Targeting GRAMD1B in Multiple Sclerosis:

    • Given GRAMD1B's downregulation in vessel-associated astrocytes of active MS lesions and its modulation by inflammatory stimuli , strategies to restore its expression or function might be beneficial

    • Small molecules that enhance GRAMD1B stability or activity could potentially modulate inflammatory responses in MS

    • Gene therapy approaches to restore GRAMD1B expression in specific CNS cell populations affected in MS represent a more targeted approach

    • Identification of the specific GRAMD1B variants associated with MS susceptibility could inform personalized therapeutic strategies

  • GRAMD1B in Cancer Therapeutics:

    • Since GRAMD1B inhibits cell migration in breast cancer by regulating JAK/STAT and Akt signaling , enhancing its expression or activity might suppress metastatic potential

    • Peptide mimetics based on the functional domains of GRAMD1B could be developed to inhibit cancer cell migration

    • Combination therapies targeting GRAMD1B along with JAK/STAT or Akt inhibitors might provide synergistic effects in cancer treatment

    • The development of GRAMD1B as a biomarker could help identify patients most likely to benefit from targeted therapies

  • Cholesterol Homeostasis Modulation:

    • GRAMD1B's role in cholesterol transport between the plasma membrane and ER suggests it could be targeted for disorders involving cholesterol dysregulation

    • Small molecules that modulate GRAMD1B's cholesterol transport activity might be useful in conditions like atherosclerosis or certain neurodegenerative diseases

    • Targeting GRAMD1B-mediated cholesterol transport could provide an alternative approach to traditional lipid-lowering therapies

  • Targeting Protein-Protein Interactions:

    • The formation of GRAMD1B complexes through specific structural elements like the amphipathic luminal helix provides potential targets for therapeutic intervention

    • Peptides or small molecules designed to interfere with specific interactions could modulate GRAMD1B function in disease contexts

    • Structural studies of the GRAMD1B interaction interfaces would facilitate rational drug design approaches

Challenges in developing GRAMD1B-targeted therapeutics include achieving cell-type specific delivery, addressing potential redundancy with other GRAMD family members, and ensuring that cholesterol homeostasis is not adversely affected in non-target tissues. Future research should focus on developing selective approaches that modulate GRAMD1B function in specific disease contexts while minimizing off-target effects.

What are the current knowledge gaps regarding GRAMD1B function?

Despite significant advances in understanding GRAMD1B, several important knowledge gaps remain that present opportunities for future research:

  • Tissue-Specific Functions:

    • While GRAMD1B is expressed in various tissues and cell types , its tissue-specific functions are not fully characterized

    • The significance of GRAMD1B expression in the adrenal gland and its potential role in steroid hormone production requires further investigation

    • How GRAMD1B function varies across different cell types and tissues remains to be systematically mapped

  • Regulation of GRAMD1B Expression and Activity:

    • The transcriptional and post-translational regulation of GRAMD1B under normal and pathological conditions is poorly understood

    • Although inflammatory stimuli downregulate GRAMD1B in peripheral monocytes , the specific signaling pathways and transcription factors involved remain uncharacterized

    • The mechanisms controlling GRAMD1B localization beyond cholesterol sensing require further elucidation

  • Interaction with Other Cellular Pathways:

    • Beyond JAK/STAT and Akt signaling , GRAMD1B likely interacts with other cellular pathways that remain to be identified

    • The interplay between GRAMD1B's roles in cholesterol transport and cell signaling represents an interesting intersection that deserves further study

    • How GRAMD1B coordinates with other lipid transport systems in maintaining cellular lipid homeostasis requires additional investigation

  • Role in Immune Function:

    • Despite expression in immune cells and potential modulation of inflammatory responses , GRAMD1B's specific role in immune function remains poorly defined

    • The mechanisms by which GRAMD1B contributes to the pathophysiology of inflammatory diseases like MS require more detailed characterization

    • The potential role of GRAMD1B in regulating immune cell migration, activation, or cytokine production represents an important area for future research

  • Structural Dynamics:

    • The complete three-dimensional structure of GRAMD1B and its conformational changes during cholesterol binding and transport have not been determined

    • The molecular mechanisms by which GRAMD1B binds and transfers cholesterol between membranes require further structural and biophysical studies

    • Understanding how the different domains of GRAMD1B cooperate functionally would provide insights for therapeutic targeting

Addressing these knowledge gaps will require integrated approaches combining advanced imaging techniques, structural biology, systems-level analyses, and improved disease models to fully elucidate the diverse functions of GRAMD1B in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.