Recombinant Human GRAM domain-containing protein 2 (GRAMD2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human GRAM Domain-Containing Protein 2 (GRAMD2) is a protein associated with alveolar type I (AT1) cells in the lungs . Initially identified as a highly specific marker for AT1 cells, GRAMD2's function was unknown, but research has since revealed its involvement in organizing membrane contact sites and its potential role in calcium signaling and lipid transport . This article aims to provide a comprehensive overview of GRAMD2, including its structural characteristics, expression patterns, functional roles, and implications in cellular biology and disease.

Expression and Localization

GRAMD2 exhibits a specific expression pattern in human tissues. Studies have confirmed that GRAMD2 is predominantly expressed in AT1 cells of the lung and is absent in bronchial epithelial cells and endothelial cells . Immunofluorescence staining has confirmed that GRAMD2 is expressed in AT1 cells and not present on the surface of AT2 cells in mouse lung .

Functional Roles

  • 4.1. Role in AT1 Cell Biology:
    GRAMD2 serves as a highly specific marker for AT1 cells, distinguishing them from other lung epithelial cells . Studies using Gramd2 CreERT2;mTmG mice, have demonstrated that GRAMD2+ AT1 cells exhibit significant plasticity, suggesting their involvement in alveolar regeneration .

  • 4.2. Regulation of Calcium Signaling:
    GRAMD2A plays a role in controlling the localization and translocation of STIM1 proteins, which are crucial for store-operated calcium entry . GRAMD2A pre-marks PI(4,5)P2-enriched ER-PM membrane contact sites for store-operated calcium entry .

  • 4.3. Membrane Contact Site Organization:
    GRAMD2 is involved in organizing membrane contact sites, which are essential for various cellular processes, including calcium signaling and lipid transport .

Research Findings and Experimental Data

  • 5.1. Identification of GRAMD2 as an AT1 Cell Marker:
    Transcriptome profiling identified GRAMD2 as a highly specific AT1 cell marker . RNA sequencing (RNAseq) confirmed that GRAMD2 is transcriptionally silent in human AT2 cells .

  • 5.2. Plasticity of GRAMD2+ AT1 Cells:
    Experiments with Gramd2 CreERT2;mTmG mice revealed that GFP effectively labels AT1 cells .

    MarkerPercentage of Co-expression with GFP
    AQP598.43 ± 0.74%
    PDPN79.42 ± 5.54%
    HOPX75.61 ± 1.52%
    IGFBP254.51 ± 3.86%
    proSFTPC0.45 ± 0.26%
  • 5.3. GRAMD2A and STIM1 Interaction:
    GRAMD2A is part of a core machinery that regulates Ca2+/STIM1 signaling at ER-PM junctions . Data suggest that GRAMD2a facilitates or is required for STIM1 recruitment to contact sites .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GRAMD2A; GRAMD2; GRAM domain-containing protein 2A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GRAMD2A
Target Protein Sequence
MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKC GREGITLNKYNQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFG KDIKVVIPVVSVQMIKKHKMARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHL QPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNIPCIPPSSVDSTDSFF PSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYEEDELEEEPR STGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPVPGHR
Uniprot No.

Target Background

Function
GRAMD2 participates in the organization of endoplasmic reticulum-plasma membrane contact sites (EPCS), playing pleiotropic roles including STIM1 recruitment and calcium homeostasis. It functions as a constitutive tether, co-localizing with ESYT2/3 tethers at EPCS in a phosphatidylinositol lipid-dependent manner. GRAMD2 pre-marks the PI(4,5)P2-enriched EPCS subset destined for the store-operated calcium entry pathway (SOCE).
Database Links

HGNC: 27287

KEGG: hsa:196996

UniGene: Hs.596332

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cell membrane; Peripheral membrane protein.

Q&A

What is the GRAM domain in GRAMD2 and how does it determine protein function?

The GRAM (Glucosyltransferases, Rab-like GTPase activators and Myotubularins) domain is approximately 70 amino acids in length and consists of a 7-stranded β sandwich and a C-terminal α-helix . In GRAMD2, the GRAM domain adopts a fold similar to pleckstrin homology (PH) domains, which are known lipid-binding modules .

The GRAM domain serves as the primary determinant for GRAMD2's subcellular localization by mediating its interaction with plasma membrane phosphoinositides, particularly PI(4,5)P2. This interaction is essential for GRAMD2's function as an ER-PM tether . When the GRAM domain is deleted (GRAMD2ΔGRAM), the protein loses its ability to localize to ER-PM contact sites and instead exhibits diffuse ER localization .

Experimentally, researchers can assess the importance of the GRAM domain through:

  • Domain deletion studies comparing wild-type GRAMD2 versus GRAMD2ΔGRAM localization

  • Site-directed mutagenesis of conserved residues within the GRAM domain

  • In vitro binding assays with recombinant GRAM domains and various phospholipids

How does GRAMD2 differ functionally from other GRAM domain-containing proteins?

Despite sharing the GRAM domain, GRAMD2 exhibits distinct characteristics compared to other family members, particularly GRAMD1a:

FeatureGRAMD2GRAMD1a
LocalizationPI(4,5)P2-dependent ER-PM contactsPI(4,5)P2-independent ER-PM contacts
Domain structureSimple GRAM domain tetherContains both GRAM and VaST domains
Response to PI(4,5)P2 depletionDissociates from PMRemains PM-associated
Functional correlationPositive correlation with calcium signalingDoes not consistently correlate with calcium pathways
Effect on ER morphologyExpands cortical ER when overexpressedMinimal effect on cortical ER morphology

Transcriptomic analyses using gene set enrichment analysis (GSEA) revealed that GRAMD2a and GRAMD1a exhibit diverse correlated pathways, with GRAMD2a showing robust positive correlations with genes involved in lipid metabolism while GRAMD1a showed opposite correlation patterns . This divergence in gene correlation patterns suggests distinct physiological functions despite their structural similarities.

The phylogenetic analysis of proteins possessing GRAM domains shows that GRAMD family members evolved with specialized functions, with GRAMD2 specifically adapted for calcium signaling roles at PI(4,5)P2-rich ER-PM contact sites .

What are the optimal protocols for expressing and purifying recombinant GRAMD2?

For studying GRAMD2 biochemistry and structure-function relationships, recombinant protein expression is essential. The following methodology has been validated for producing soluble GRAMD2:

  • Clone design and expression system:

    • Generate a truncated construct lacking the C-terminal transmembrane domain (GRAMD2ΔTM: amino acids 1-298)

    • Clone into pET15b vector with an N-terminal His6 tag

    • Transform into BL21 E. coli containing RIPL plasmid (encoding nonabundant tRNAs)

  • Expression conditions:

    • Grow cultures at 37°C to OD600 0.7

    • Induce with 0.5 mM IPTG for 2 hours

    • Harvest cells by centrifugation

  • Purification procedure:

    • Resuspend in buffer (50 mM Hepes, pH 8, 500 mM NaCl, 350 µg/ml PMSF, 1x PI cocktail, 2 mM BME)

    • Lyse in a microfluidizer and add Triton X-100 to 0.1%

    • Remove insoluble materials by ultracentrifugation (35,000 rpm, 45 min)

    • Purify using Ni-IDA resin on FPLC with specific wash and elution buffers

  • Buffer optimization for storage:

    • Dialyze pooled peak fractions into storage buffer (50 mM Hepes, pH 8, 150 mM NaCl, 2 mM BME, 10% glycerol)

    • Store in 30 µL aliquots at -80°C for maximum stability

This protocol typically yields milligram quantities of purified recombinant GRAMD2ΔTM suitable for in vitro binding assays, structural studies, and biochemical characterization.

How can researchers effectively assess GRAMD2's phospholipid binding specificity?

To determine GRAMD2's lipid-binding properties, the following liposome binding assay has proven effective:

  • Liposome preparation:

    • Generate liposomes with defined lipid compositions containing various phosphoinositides

    • Include control liposomes lacking target phosphoinositides

    • Standardize phospholipid concentrations (typical final concentration: 1.2 mg/mL)

  • Binding reaction setup:

    • Incubate liposomes with purified recombinant GRAMD2ΔTM (1.2 μM)

    • Maintain reaction at room temperature for 90 minutes

    • Ensure consistent buffer conditions across all samples

  • Separation and analysis:

    • Separate bound and unbound fractions by ultracentrifugation (40,000 g, 30 min, 4°C)

    • Collect supernatant (unbound) and resuspend pellet (bound) in equivalent volumes

    • Analyze by western blotting using anti-His6 antibody

    • Quantify using imaging systems like LI-COR Odyssey

  • Data interpretation:

    • Calculate binding percentages by densitometry

    • Compare binding preferences across different phosphoinositide species

    • Evaluate concentration-dependent binding effects

This methodology allows researchers to determine which phosphoinositides GRAMD2 preferentially binds, providing insights into its targeting mechanism to specific membrane domains in cells.

What cellular imaging approaches best capture GRAMD2 dynamics at ER-PM contact sites?

Given GRAMD2's localization to specialized ER-PM contact sites, advanced imaging techniques are required to properly visualize its distribution and dynamics:

  • Total Internal Reflection Fluorescence (TIRF) microscopy:

    • Ideal for visualizing GRAMD2 at the cell cortex with minimal background from intracellular structures

    • Can resolve individual GRAMD2 puncta at ER-PM contacts

    • Enables quantification of cortical ER area marked by GRAMD2

  • Live-cell imaging approaches:

    • Fluorescently tagged GRAMD2 constructs (GRAMD2-mCherry or GRAMD2-eGFP)

    • Time-lapse imaging to capture GRAMD2 dynamics during stimulation

    • Particularly useful for monitoring GRAMD2 responses to PM PI(4,5)P2 depletion

  • Co-localization strategies:

    • Simultaneous imaging of GRAMD2 with other ER-PM tethers (E-Syt2/3)

    • Dual-color imaging with STIM1 during calcium store depletion

    • Comparison with phosphoinositide biosensors (CFP-PH-PLCδ1)

  • Super-resolution microscopy:

    • Techniques like STORM or PALM can resolve nanoscale organization of GRAMD2 at contact sites

    • Provides detailed spatial relationships between GRAMD2 and other contact site proteins

  • Quantitative analysis methods:

    • GRAMD2 puncta count, size, and intensity measurements

    • Co-localization coefficients with other markers

    • Kinetic analysis of recruitment/dissociation during stimulation

These imaging approaches have revealed that GRAMD2 pre-marks specific cortical ER sites that are subsequently utilized by STIM1 during store-operated calcium entry, demonstrating its role in organizing specialized membrane microdomains .

What is GRAMD2's specific role in store-operated calcium entry (SOCE)?

GRAMD2 plays a critical role in organizing ER-PM contact sites required for efficient SOCE:

  • Pre-marking ER-PM sites for STIM1 recruitment:

    • GRAMD2 localizes to specific ER-PM contact sites in resting cells

    • Following ER Ca²⁺ depletion, STIM1 preferentially translocates to these GRAMD2-marked sites

    • Time-course imaging reveals STIM1 accumulation at pre-existing GRAMD2 puncta

  • Functional impact on STIM1 recruitment dynamics:

    • In GRAMD2 knockout cells generated via CRISPR:

      • STIM1 translocation to the PM is significantly reduced and delayed

      • The average area of STIM1 cortical puncta is approximately 2-fold smaller

      • These defects are fully rescued by re-expressing GRAMD2-eGFP

  • Mechanistic basis:

    • GRAMD2 organizes PI(4,5)P2-rich domains at ER-PM contacts

    • These PI(4,5)P2 domains serve as platforms for STIM1 recruitment via its C-terminal polybasic tail

    • STIM1 mutants lacking the PI(4,5)P2-binding domain (STIM1ΔK) show impaired targeting to GRAMD2-marked sites

  • Correlation with calcium signaling pathways:

    • Gene set enrichment analysis shows strong positive correlations between GRAMD2a expression and calcium signaling pathways

    • This correlation is consistent across both human and mouse transcriptomic datasets

The experimental evidence collectively indicates that GRAMD2 functions as an organizer of specialized ER-PM contacts that facilitate efficient STIM1 recruitment during SOCE, thereby optimizing cellular calcium signaling responses.

How do researchers distinguish between different types of ER-PM contact sites marked by various tether proteins?

The ER-PM interface contains multiple distinct contact sites marked by different tether proteins. Researchers employ several strategies to distinguish these domains:

  • Multi-color fluorescence microscopy:

    • Co-expression of differently tagged ER-PM tethers (e.g., GRAMD2a-mCherry with E-Syt2-GFP)

    • Quantification of overlap coefficients between different markers

    • Analysis has revealed that GRAMD2a and GRAMD1a occupy largely distinct ER-PM subdomains with only approximately 15% overlap

  • Sequential stimulation protocols:

    • Different ER-PM tethers respond distinctively to specific stimuli

    • For example, PI(4,5)P2 depletion through PLC activation causes GRAMD2a to dissociate from the PM while GRAMD1a remains associated

    • These differential responses allow functional distinction between contact sites

  • Knockout/knockdown studies:

    • Genetic deletion of specific tethers helps define their unique contributions

    • For instance, GRAMD2a knockout specifically affects STIM1 recruitment during SOCE

    • In contrast, deletion of all three E-Syts has minimal effect on STIM1 function

  • Lipidomic profiling:

    • Different contact sites are enriched in specific lipid compositions

    • Contact site isolation followed by lipidomic analysis can reveal these distinctions

    • GRAMD2a shows specific dependence on PI(4,5)P2, while GRAMD1a does not

  • Transcriptomic correlation analysis:

    • GRAMD2a exhibits robust positive correlations with genes involved in calcium signaling

    • GRAMD1a shows distinct correlation patterns with lipid metabolism genes

    • These divergent correlation patterns support their functional specialization

This multi-faceted approach has established that ER-PM contacts are functionally specialized domains rather than homogeneous structures, with GRAMD2 specifically organizing contacts dedicated to SOCE.

What is known about GRAMD2 expression and function in alveolar type I (AT1) cells?

Recent research has revealed significant insights about GRAMD2 in lung alveolar epithelium:

  • Expression pattern in lung tissue:

    • Immunofluorescence staining confirms GRAMD2 expression in AT1 cells but not AT2 cells

    • AT1-specific localization was validated using GRAMD2-CreERT2 mice crossed with mTmG reporter mice

    • This expression pattern makes GRAMD2 a valuable marker for AT1 cells

  • Biochemical characterization of GRAMD2+ cells:

    • FACS-isolated GRAMD2+ cells from mouse lungs exhibit high expression of AT1 markers:

      • 98.43 ± 0.74% express AQP5

      • 79.42 ± 5.54% express PDPN

      • 75.61 ± 1.52% express HOPX

      • 54.51 ± 3.86% express IGFBP2

    • Importantly, only 0.45 ± 0.26% express the AT2 marker proSFTPC, confirming specificity

  • Cellular plasticity and potential for regeneration:

    • GRAMD2+ AT1 cells demonstrate remarkable plasticity in 3D culture conditions

    • These cells can form organoids and transit through multiple epithelial cell states

    • Single-cell RNA sequencing reveals significant transcriptional plasticity

    • This unexpected plasticity suggests GRAMD2+ AT1 cells may contribute to alveolar regeneration

  • Research applications:

    • GRAMD2-CreERT2 mice represent a valuable tool for studying AT1 cell biology

    • These genetic models enable lineage tracing of AT1 cells during development, homeostasis, and disease

    • The ability to identify and isolate GRAMD2+ AT1 cells facilitates ex vivo and in vitro studies

These findings challenge the traditional view of AT1 cells as terminally differentiated cells with limited regenerative capacity, suggesting new directions for research on lung injury and repair mechanisms.

How can transcriptomic approaches advance our understanding of GRAMD2 function?

Transcriptomic analysis offers powerful insights into GRAMD2's biological contexts and potential functions:

  • Gene expression correlation analyses:

    • Gene set enrichment analysis (GSEA) using GRAMD2a expression levels as input phenotypes revealed:

      • Strong positive correlations with calcium signaling pathways

      • Positive correlations with lipid metabolism genes

      • These correlations were consistent across both human and mouse datasets

  • Single-cell RNA sequencing applications:

    • scRNAseq of GRAMD2+ cells from lung tissue has revealed:

      • Transcriptional heterogeneity within the AT1 cell population

      • Dynamic state transitions during 3D culture

      • Gene expression changes associated with cellular plasticity

  • Comparative transcriptomics:

    • Analysis of differential gene expression between:

      • GRAMD2a-knockout versus wild-type cells

      • Tissues with high versus low GRAMD2a expression

      • Different physiological or pathological states

    • These comparisons can identify gene networks functionally linked to GRAMD2a

  • Integration with public databases:

    • The Gene Expression Omnibus (GEO) database contains extensive RNA-seq datasets that can be mined for GRAMD2-related insights

    • GEO facilitates meta-analysis across multiple studies and experimental conditions

    • Analysis tools like GEO2R with its interactive plots (volcano plots, mean difference plots, UMAP) can identify differentially expressed genes related to GRAMD2 function

  • Methodological considerations:

    • Adjustment for multiple comparisons to control false discovery rate is essential

    • The empirical Bayes test is more appropriate than traditional statistical tests for microarray data

    • Both p-value and fold change criteria should be considered for identifying differentially expressed genes

These transcriptomic approaches provide a systems-level view of GRAMD2 function, identifying its involvement in specific biological processes and potential regulatory networks.

What are the key unresolved questions about GRAMD2 function and regulation?

Despite significant progress, several critical knowledge gaps remain in GRAMD2 research:

  • Structural determinants of lipid binding:

    • While the GRAM domain is known to bind phosphoinositides, the specific residues mediating this interaction remain incompletely characterized

    • The structural basis for GRAMD2's preference for PI(4,5)P2 over other phosphoinositides requires further elucidation

    • X-ray crystallography or cryo-EM studies of GRAMD2-lipid complexes would provide valuable insights

  • Regulatory mechanisms:

    • How GRAMD2 expression and localization are regulated under different physiological conditions

    • Potential post-translational modifications affecting GRAMD2 function

    • Whether GRAMD2 undergoes conformational changes upon lipid binding

  • Protein-protein interaction network:

    • Beyond STIM1, the complete interactome of GRAMD2 remains undefined

    • Potential interactions with other calcium signaling proteins or ER-PM tethers

    • How these interactions are regulated during cellular responses

  • Physiological and pathological significance:

    • The role of GRAMD2 in specific tissues beyond lung AT1 cells

    • Potential involvement in diseases associated with calcium dysregulation

    • Whether GRAMD2 mutations or dysregulation contribute to human disorders

  • Evolutionary aspects:

    • How GRAMD2 function has evolved across species in relation to calcium signaling systems

    • The functional divergence between GRAMD2 and other GRAM domain proteins

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, cell biology, and in vivo studies.

How can "People Also Ask" data from Google inform GRAMD2 research priorities?

Google's "People Also Ask" (PAA) feature provides valuable insights into knowledge gaps and research priorities by revealing questions frequently asked about specific topics :

  • Identifying knowledge gaps:

    • PAA data appears in over 80% of English searches, providing extensive coverage of research topics

    • The questions reveal areas where information is sought but potentially unavailable or unclear

    • For GRAMD2 research, PAA data can highlight aspects of the protein's function that generate the most queries

  • Understanding search behavior patterns:

    • PAA results tell researchers about searcher behavior patterns and how Google interprets queries

    • This provides insights into how the scientific community and public understand GRAMD2

    • Such understanding can help researchers frame their findings for maximum impact

  • Methodological applications:

    • PAA data can be mined using specialized tools that extract questions directly from Google

    • These tools organize questions into clusters based on search intent

    • For GRAMD2 research, this clustering could reveal distinct aspects of interest (structure, function, disease relevance)

  • Research communication strategy:

    • Addressing common questions in research publications can enhance their visibility and impact

    • Understanding what questions researchers are asking about GRAMD2 can guide how findings are communicated

    • This approach aligns with the recognition that for complex queries, users often need multiple searches to complete a task

  • Implementation for GRAMD2 research:

    • Researchers can use PAA data to identify specific aspects of GRAMD2 that generate the most interest

    • These insights can inform grant applications by highlighting the perceived importance of different research directions

    • Regular monitoring of PAA can track how research questions evolve as new findings emerge

By integrating PAA data analysis into research planning, GRAMD2 researchers can align their investigations with both scientific priorities and information needs within the research community.

What are the most promising methodological innovations for studying GRAMD2 at ER-PM contact sites?

Recent technological advances offer new opportunities for investigating GRAMD2 function at ER-PM contact sites:

  • Proximity labeling techniques:

    • BioID or APEX2 fused to GRAMD2 can identify proteins in its immediate vicinity at ER-PM contacts

    • This approach can reveal the proteome of GRAMD2-specific ER-PM domains

    • Comparative analysis with other ER-PM tethers can highlight unique components of GRAMD2 domains

  • Advanced microscopy approaches:

    • Lattice light-sheet microscopy enables 3D visualization of ER-PM contacts with minimal phototoxicity

    • Super-resolution techniques (STED, PALM, STORM) resolve nanoscale organization of GRAMD2 at contacts

    • Correlative light and electron microscopy (CLEM) connects GRAMD2 fluorescence with ultrastructural features

  • Optogenetic and chemogenetic tools:

    • Light-inducible dimerization systems fused to GRAMD2 enable acute manipulation of ER-PM contacts

    • Rapid recruitment or displacement of GRAMD2 from contacts allows temporal dissection of its function

    • These approaches can distinguish between structural and signaling roles of GRAMD2

  • Engineered lipid sensors and manipulators:

    • Genetically encoded biosensors for PI(4,5)P2 enable real-time monitoring of lipid dynamics at GRAMD2 sites

    • Inducible lipid-modifying enzymes allow acute manipulation of phosphoinositides at ER-PM contacts

    • These tools help define the lipid requirements for GRAMD2 localization and function

  • Cryo-electron tomography:

    • Direct visualization of native ER-PM contacts in frozen cells

    • Immunogold labeling of GRAMD2 can reveal its precise positioning within contact site architecture

    • This approach provides structural insights at near-atomic resolution

  • Genome editing with spatial control:

    • CRISPR-based approaches with tissue-specific or inducible control

    • Precise modification of endogenous GRAMD2 to introduce tags or mutations

    • These techniques enable study of GRAMD2 under physiological expression levels

These methodological innovations are transforming our ability to study dynamic ER-PM contact sites and will likely reveal new aspects of GRAMD2 function in calcium signaling and membrane organization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.