Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
gD; US6; Envelope glycoprotein D; gD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-393
Protein Length
Full Length of Mature Protein
Species
Human herpesvirus 1 (strain HZT) (HHV-1) (Human herpes simplex virus 1)
Target Names
gD
Target Protein Sequence
KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPNPFQPPSLPITVYRR VERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYN KSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFIL EHRAKGSCKYTLPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGW HGPRAPYTSTLLPPELPETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQD AATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMRRRTRKAPKRIRLPHIREDDQP SSHQPLFY
Uniprot No.

Target Background

Function

Envelope glycoprotein that binds to host cell entry receptors TNFRSF14/HVEM, NECTIN1, and 3-O-sulfated heparan sulfate. It may trigger membrane fusion by recruiting the fusion machinery (gB and gH/gL).

Protein Families
Herpesviridae glycoprotein D family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus.

Q&A

What is the role of glycoprotein D in HSV-1 infection?

HSV-1 envelope glycoprotein D (gD) is essential for viral entry into host cells, serving as the primary receptor-binding protein. During infection, gD interacts with specific cell surface receptors to initiate the virus-cell membrane fusion process . Beyond viral entry, gD performs several additional critical functions, including:

  • Mediating cell-cell spread of the virus during infection

  • Blocking superinfection of already infected cells

  • Preventing apoptosis in infected cells lacking the gene encoding gD

  • Contributing to viral final envelopment through its cytoplasmic domain

The multifunctionality of gD makes it a central player in HSV-1 pathogenesis and an important target for antiviral strategies and vaccine development.

Which cellular receptors does HSV-1 gD interact with during viral entry?

HSV-1 gD determines which cells can be infected by binding to one of several alternative cell surface receptors. These interactions are critical for understanding viral tropism and developing entry inhibitors. The primary receptors include:

  • Herpesvirus entry mediator (HVEM), a member of the tumor necrosis receptor family

  • Nectin-1 (also known as HveC), a member of the nectin family involved in cell adhesion

  • Nectin-2, another member of the nectin family (though less efficient for HSV-1 entry)

  • Sites in heparan sulfate generated by specific 3-O-sulfotransferases

Different domains of gD interact with these receptors, with some structural overlap. Importantly, receptor usage varies by cell type. Nectins are the principal entry receptors for human neuronal and epithelial cell lines, while both HVEM and nectins can mediate entry into T lymphocyte lines . This differential receptor usage impacts viral pathogenesis and tissue tropism.

What are the structural domains of HSV-1 gD and their functions?

HSV-1 gD has distinct structural domains that contribute to its various functions. Understanding these domains is crucial for structure-function analyses and targeted modifications:

Mutations affecting specific domains can selectively impact functions. For example, substitutions at positions 215, 222, and 223 markedly reduce binding to nectin-1 and prevent cell fusion or viral entry via nectin-1 or nectin-2, while not significantly inhibiting interactions with HVEM . Similarly, deletion Δ277-310 affects fusion without hampering nectin-1 binding, identifying a region involved in fusion activity at a post-binding step .

How is recombinant HSV-1 gD typically produced for research purposes?

Production of recombinant HSV-1 gD requires careful consideration of expression systems, purification methods, and quality control. The methodological approach typically involves:

Expression Systems:

  • Bacterial expression (E. coli): Cost-effective but may lack proper glycosylation

  • Mammalian cell lines: Provide proper post-translational modifications

  • Baculovirus-insect cell systems: Balance between yield and post-translational modifications

Production Protocol Overview:

  • Clone the gD gene into an appropriate expression vector

  • Transform/transfect host cells with the expression construct

  • Induce protein expression under optimized conditions

  • Harvest cells and extract protein using suitable lysis buffers

  • Purify recombinant gD using affinity chromatography (often via His-tag, SUMO-tag, or immunoaffinity approaches)

  • Perform additional purification steps (ion exchange, size exclusion chromatography)

  • Verify purity by SDS-PAGE (>90% purity is typically desirable)

  • Confirm identity and activity through Western blotting and functional assays

Critical Considerations:

  • Proper folding is essential for receptor-binding activity - denatured forms lose the ability to bind HVEM-expressing cells

  • N-terminal and C-terminal tags can facilitate purification but may affect function

  • For some applications, soluble truncated forms (such as gD-1t) may be preferable to full-length gD

The choice of production method should align with the intended application, as structural integrity directly impacts biological activity.

What methods are used to assess the functional activity of recombinant HSV-1 gD?

Verifying that recombinant gD retains native functionality is crucial for experimental validity. Several complementary approaches can be employed:

Receptor Binding Assays:

  • Cell-based binding assays using HVEM or nectin-expressing cells

  • ELISA-based binding assays with soluble receptor forms

  • Surface plasmon resonance for kinetic and affinity measurements

  • Flow cytometry to measure binding to receptor-expressing cells

Functional Assays:

  • Cell fusion assays measuring gD-mediated membrane fusion

  • Viral entry inhibition assays

  • Competition assays with virus or soluble receptors

Immunological Activity Assessment:

  • T-cell proliferation assays measuring lymphocyte responses to gD

  • Cytokine production (IFN-γ, IL-2) measurement in response to gD stimulation

  • Dendritic cell activation assays when evaluating adjuvant properties

Recombinant gD should be tested against appropriate positive controls (such as native gD) and negative controls. For example, studies have shown that soluble recombinant gDs, but not denatured forms, retain the ability to bind surface-exposed cellular receptors of HVEM-expressing U937 cells .

How do mutations in different domains of HSV-1 gD affect its functions in viral entry and cell-cell fusion?

Mutational analysis of gD provides critical insights into structure-function relationships and receptor specificity. Research has identified several key regions where mutations have distinct functional consequences:

Receptor-Binding Domain Mutations:

  • Substitutions at positions 215, 222, and 223 markedly reduce binding to nectin-1 and prevent cell fusion or viral entry via nectins, while either enhancing or not significantly inhibiting interactions with HVEM

Structural Domain Mutations:

Post-Binding Functional Domain Mutations:

  • Deletion Δ277-310 affects fusion without hampering nectin1 binding, identifying a region involved in fusion activity at a post-binding step

Cytoplasmic Domain Mutations:

  • Alterations in the arginine cluster in the cytoplasmic domain impair the formation of microvillus-like projections at the plasma membrane and viral final envelopment

These findings demonstrate that different domains of gD, with some overlap, are critical for functional interactions with each class of entry receptor and with other viral or cellular proteins involved in fusion.

What mechanisms underlie the adjuvant effect of HSV-1 gD in enhancing immune responses?

HSV-1 gD possesses significant immunomodulatory properties that can be harnessed for vaccine development. The underlying mechanisms include:

HVEM-BTLA Pathway Modulation:

  • gD binds to HVEM, a member of the tumor necrosis factor receptor family

  • This interaction blocks the coinhibitory mechanism mediated by B- and T-lymphocyte attenuator (BTLA)

  • Blocking BTLA inhibition enhances T cell activation and proliferation

Enhanced Antigen-Specific Immune Responses:

  • gD particularly enhances CD8+ T cell responses when fused with target antigens

  • The adjuvant effect does not require endogenous synthesis of the antigen or gD

  • In vivo administration of recombinant gD, particularly when genetically fused with antigens (e.g., gDE7 with HPV-16 E7), promotes:

    • Activation of dendritic cells

    • Generation of antigen-specific cytotoxic CD8+ T cells

    • Development of preventive and partial therapeutic antitumor protection

T-Cell Response Profile:

  • gD stimulates lymphocyte proliferation and production of gamma interferon (IFN-γ) and interleukin-2 (IL-2) in seropositive individuals

  • Native gD (ngD) stimulates IL-2 and lymphocyte transformation responses similar to whole-virus antigen and higher than those of ngC

These immunomodulatory properties make recombinant gD an attractive candidate for incorporation into vaccine designs, particularly for enhancing cellular immune responses.

How does the cytoplasmic domain of HSV-1 gD contribute to viral replication and cell-cell spread?

The cytoplasmic domain of HSV-1 gD plays multiple roles beyond receptor binding, particularly in membrane remodeling processes essential for viral pathogenesis:

Key Functions of the gD Cytoplasmic Domain:

  • Formation of microvillus-like projections at the plasma membrane of infected cells

  • Contribution to viral final envelopment in HSV-1-infected cells

  • Promotion of efficient HSV-1 replication and cell-cell spread

The Arginine Cluster:

  • A critical feature within the cytoplasmic domain is an arginine cluster

  • This cluster is required for the formation of plasma membrane projections in HSV-1-infected cells

  • The arginine cluster also facilitates viral envelopment processes

Membrane Remodeling:

  • HSV-1 infection induces deformation of various host cell membranes

  • The cytoplasmic domain of gD contributes to these membrane alterations

  • These changes facilitate both viral assembly and cell-to-cell spread

Understanding these roles of the gD cytoplasmic domain provides insights into the complex processes of viral morphogenesis and spread, which may identify new targets for antiviral intervention.

What are the methodological considerations for using recombinant HSV-1 gD in T-cell response assays?

When using recombinant HSV-1 gD to study T-cell responses, several methodological considerations are crucial for obtaining reliable and interpretable results:

Preparation of Recombinant gD:

  • Ensure proper folding and preservation of native conformational epitopes

  • Confirm receptor-binding activity before use in assays

  • Use appropriate concentrations (typically higher concentrations of purified recombinant proteins are needed compared to whole virus antigen)

Assay Design:

  • Include appropriate controls (whole HSV-1 antigen as positive control, irrelevant proteins as negative controls)

  • Consider using combinations of glycoproteins (e.g., ngB plus ngD or ngB plus ngC plus ngD) which can stimulate stronger responses than individual proteins

  • Use recombinant IL-2 to enhance lymphocyte transformation and IFN-γ responses in antigen-driven cultures when needed

Subject Selection and Cell Preparation:

  • Clearly define subject populations (seropositive vs. seronegative)

  • Consider using specific cell populations (e.g., plastic-nonadherent blood cells) to detect changes in frequency of HSV-responsive cells after lesion recurrence

  • Document time since last herpetic lesion, as this can affect response magnitude

Readout Methods:

  • Measure multiple parameters (lymphocyte proliferation, IFN-γ production, IL-2 production)

  • Consider the kinetics of the response (typically 5-7 days for proliferation assays)

  • For predictive studies, note that IFN-γ induced by rgD-1t has been shown to correlate with time to next herpetic lesion in volunteers

Studies have shown that while purified recombinant gD can elicit specific T-cell responses, the magnitude and frequency of these responses are typically lower than with whole-virus antigen, suggesting that optimal assay conditions may require adjustment from standard protocols used with whole virus .

How can recombinant HSV-1 gD be engineered as a vaccine adjuvant or for targeting specific cell types?

Recombinant HSV-1 gD offers versatile platforms for enhancing vaccine efficacy and targeting delivery to specific cell types:

Engineering Strategies for Vaccine Adjuvants:

  • Direct genetic fusion with target antigens at the C-terminal end

  • Fusion protein expression in bacterial or mammalian systems

  • Co-administration of soluble recombinant gD with target antigens

Proven Approach with HPV-16 E7:

  • Genetic fusion of gD with HPV-16 E7 oncoprotein (gDE7) has shown:

    • Enhanced activation of dendritic cells

    • Improved antigen-specific cytotoxic CD8+ T cell responses

    • Complete preventive and partial therapeutic antitumor protection in mice

Receptor-Targeting Applications:

  • Engineering gD variants with altered receptor specificity allows targeting of specific cell types

  • Mutations in positions 215, 222, and 223 can selectively impair nectin binding while preserving HVEM interactions

  • Such constructs could be used to target HVEM-expressing cells like T lymphocytes while avoiding nectin-expressing cells

Optimization Considerations:

  • Preserve the natural conformation of gD for optimal receptor binding

  • Position of the target antigen relative to gD affects immunogenicity

  • For therapeutic applications, combination with other immunomodulators may enhance efficacy

These approaches leverage the intrinsic immunostimulatory properties of gD to enhance antigen-specific immune responses, making it a valuable tool for vaccine development and immunotherapy.

What are the current technical challenges in working with recombinant HSV-1 gD?

Despite its research value, several technical challenges complicate work with recombinant HSV-1 gD:

Production Challenges:

  • Ensuring proper folding and glycosylation in recombinant expression systems

  • Balancing yield with biological activity

  • Maintaining stability during purification and storage

  • Achieving consistent batch-to-batch reproducibility

Functional Assessment Challenges:

  • Differentiating between effects on different functions (receptor binding vs. fusion vs. immunomodulation)

  • Quantifying binding to different receptors with varying affinities

  • Distinguishing direct effects from indirect consequences in complex biological systems

Experimental Design Considerations:

  • The magnitude and frequency of immune responses to recombinant gD are typically lower than with whole-virus antigen, requiring optimization of experimental conditions

  • Different domains of gD interact with multiple partners, complicating interpretation of mutation studies

  • Glycosylation of gD is required for some functions, such as blocking apoptosis, suggesting potential limitations of bacterial expression systems

Translational Research Challenges:

  • Ensuring recombinant constructs maintain immunogenicity across species

  • Predicting human responses based on animal models

  • Optimizing fusion constructs for maximum adjuvant effect while minimizing potential adverse effects

Addressing these challenges requires interdisciplinary approaches combining structural biology, protein engineering, immunology, and virology.

How can contradictory findings about HSV-1 gD function be reconciled in experimental design?

The scientific literature contains seemingly contradictory findings about HSV-1 gD functions, creating challenges for experimental design. Methodological approaches to address these contradictions include:

Standardizing Experimental Systems:

  • Use consistent cell lines and expression systems across comparative studies

  • Define standard recombinant gD preparations for reference

  • Establish benchmark assays for each functional property

Systematic Analysis of Variables:

  • Cell type influences: Different receptors predominate on different cell types, affecting outcomes

    • Nectins are principal entry receptors for neuronal and epithelial cells

    • HVEM or nectins mediate entry into T lymphocyte lines

  • Virus strain differences: Compare results across multiple HSV-1 strains

  • Protein context: Evaluate gD function in multiple contexts (soluble vs. membrane-anchored, virus-associated vs. recombinant)

Multi-parametric Analysis:

  • Simultaneously measure multiple functional outcomes

  • Track structure-function relationships systematically

  • Consider temporal dynamics of interactions

Integrative Approaches to Resolve Contradictions:

  • Combinations of glycoproteins (ngB plus ngD or ngB plus ngC plus ngD) stimulate immune responses equivalent to whole-virus antigen, suggesting cooperation between viral proteins

  • Different domains of gD interact with different partners, explaining how mutations can selectively affect certain functions

  • Some functions require glycosylation (e.g., blocking apoptosis) while others do not, explaining discrepancies between expression systems

By carefully controlling for these variables and using integrative approaches, researchers can develop more robust experimental designs that account for the multifunctional nature of HSV-1 gD.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.