Recombinant Human herpesvirus 1 Envelope glycoprotein E (gE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Herpesvirus 1 Envelope Glycoprotein E (gE)

Recombinant Human Herpesvirus 1 Envelope glycoprotein E (gE), also known as US8 envelope glycoprotein E, is a protein encoded by the US8 gene in Herpes Simplex Virus type 1 (HSV-1) . Glycoprotein E is a viral envelope protein that plays a crucial role in various aspects of the virus's life cycle, including cell-to-cell transmission, neurovirulence, and immune evasion . Although gE is not essential for viral replication, it interacts with other viral proteins to facilitate virion secondary envelopment and cell-to-cell transmission .

Structure and Properties of gE

HSV-1 gE is a major virulence determinant of the virus and has been explored in vaccine development strategies . Alphaherpesviruses encode for 23 envelope proteins that have different roles in primary infection, secondary envelope, cell-to-cell spread, and immune evasion .

Role of gE in the Viral Life Cycle

gE plays a significant role in the herpesvirus life cycle.

  • Secondary Envelopment: gE is important in the secondary envelopment of cytoplasmic nucleocapsids. Deletion of gE can result in capsid accumulation around vesicles, which inhibits virion formation, suggesting gE's role in the secondary envelope coating of the cytoplasmic nucleocapsid .

  • Interaction with Other Viral Proteins: gE interacts with other tegument proteins to form complexes, which promotes secondary envelopment, facilitates virus-infected cell-to-cell fusion, and releases mature virions .

  • Immune Evasion: gE, in combination with gI, interacts with the Fc fragment of immunoglobulin G (IgG) to modulate the phosphorylation of extracellular regulated protein kinases 1/2 (ERK1/2), which facilitates immune evasion by the virus after infection .

gE Interactions with Other Proteins

gE interacts with other proteins, and these interactions mediate multiple functions during the viral life cycle .

Viral ProteinInteraction with gE
gIgE normally forms a heterodimer with gI, encoded by the US7 gene. The gE/gI heterodimer participates in multiple viral functions. The gE/gI heterodimer interacts with the Fc fragment of IgG to regulate the phosphorylation of extracellular regulated protein kinases 1/2 (ERK1/2), facilitating immune evasion .
gNGlycoprotein M can also be localized to the Golgi apparatus, and when gM is co-expressed with other glycoproteins, then their localization may be changed by gM and relocated to the correct assembly site that can facilitate proteins rightly assemble to virion during secondary envelopment .

gE in Vaccine Development

  • Attenuated Vaccines: The gE gene is a frequent target for constructing gene-deleted attenuated marker vaccines .

  • Protective Efficacy: Studies have explored the protective efficacy of recombinant gE in animal models. For instance, mice vaccinated with a secreted form of gE developed high serum titers of HSV-1-neutralizing antibodies and were significantly protected from lethal HSV-1 challenge .

  • T-Lymphocyte Responses: gE can stimulate T-lymphocyte responses in humans, suggesting its potential in stimulating an immune T-helper-cell response associated with preventing human herpes simplex lesion recurrence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gE; US8; Envelope glycoprotein E; gE; gE-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-550
Protein Length
full length protein
Species
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Target Names
gE
Target Protein Sequence
GTPKTSWRRVSVGEDVSLLPAPGPTGRGPTQKLLWAVEPLDGCGPLHPSWVSLMPPKQVP ETVVDAACMRAPVPLAMAYAPPAPSATGGLRTDFVWQERAAVVNRSLVIHGVRETDSGLY TLSVGDIKDPARQVASVVLVVQPAPVPTPPPTPADYDEDDNDEGEDESLAGTPASGTPRL PPPPAPPRSWPSAPEVSHVRGVTVRMETPEAILFSPGETFSTNVSIHAIAHDDQTYSMDV VWLRFDVPTSCAEMRIYESCLYHPQLPECLSPADAPCAASTWTSRLAVRSYAGCSRTNPP PRCSAEAHMEPVPGLAWQAASVNLEFRDASPQHSGLYLCVVYVNDHIHAWGHITISTAAQ YRNAVVEQPLPQRGADLAEPTHPHVGAPPHAPPTHGALRLGAVMGAALLLSALGLSVWAC MTCWRRRAWRAVKSRASGKGPTYIRVADSELYADWSSDSEGERDQVPWLAPPERPDSPST NGSGFEILSPTAPSVYPRSDGHQSRRQLTTFGSGRPDRRYSQASDSSVFW
Uniprot No.

Target Background

Function

In epithelial cells, the gE/gI heterodimer is essential for cell-to-cell viral spread. It facilitates the targeting of nascent virions to cell junctions, enabling rapid spread to adjacent cells via interactions with junctional cellular receptors. It's implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is crucial for anterograde infection spread throughout the nervous system. In conjunction with US9, gE/gI participates in the sorting and axonal transport of viral structural components. Furthermore, the gE/gI heterodimer acts as a receptor for the Fc region of host IgG, dissociating at acidic pH. This suggests involvement in immune evasion by mediating bipolar bridging of anti-HSV antibodies, followed by intracellular endocytosis and degradation, thus interfering with host IgG-mediated immune responses.

Gene References Into Functions
  1. The interaction between Us9 and gE appears weak and disrupted by ionic detergents in wild-type infected cells. PMID: 27568015
  2. gE-gI mediates the clearance of antiviral host IgG and viral antigens from infected cell surfaces, contributing to immune evasion. PMID: 24604090
  3. A highly conserved acidic cluster within the Us9 protein is critical for genome transport to the distal axon, with transport less dependent on Us9 expression in the NS compared to the F strain virus. PMID: 23322573
  4. The HSV-1 FcgammaR promotes immune evasion from IgG Fc-mediated activities and likely contributes to virulence during recurrent infections. PMID: 21228231
  5. HSV proteins VP22 and UL11 specifically interact with the C-terminal domain of glycoprotein E. PMID: 17035313
  6. gE recruits VP22 to the Golgi region of transfected cells. PMID: 19279114
Database Links

KEGG: vg:2703448

Protein Families
Alphaherpesvirinae glycoprotein E family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus membrane; Single-pass membrane protein. Host endosome membrane; Single-pass membrane protein. Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein. The heterodimer gE/gI then redistributes to cell junctions to promote cell-cell spread later in the infection.

Q&A

What is glycoprotein E (gE) in Herpes Simplex Virus Type 1?

Glycoprotein E is an essential envelope protein embedded in the HSV-1 viral membrane that extends into both the extracellular environment and cytoplasmic space. As a viral surface protein, gE plays multiple roles in the viral life cycle, particularly in cell-to-cell spread and virus-induced cell fusion . The protein undergoes extensive post-translational modifications, including N-glycosylation, O-glycosylation, and sialylation, which are critical for its proper function. gE belongs to the broader family of herpesvirus envelope glycoproteins that mediate crucial interactions between the virus and host cells during infection.

What are the primary functions of HSV-1 gE?

HSV-1 glycoprotein E serves several essential functions during viral infection:

  • Cell-to-cell spread: gE plays a key role in facilitating direct virus transmission between adjacent cells, which allows the virus to evade neutralizing antibodies in the extracellular environment .

  • Virus-induced cell fusion: gE contributes significantly to the fusion of infected cells with neighboring uninfected cells, forming multinucleated syncytia that facilitate viral spread .

  • Axonal localization: Research has shown that gE is required for the proper localization of viral capsid, tegument, and membrane glycoproteins in axons, which is crucial for neuronal infection .

  • Targeting to epithelial cell junctions: gE, often in complex with glycoprotein I (gI), sorts nascent virions to epithelial cell junctions, promoting efficient viral spread in epithelial tissues .

  • Retrograde spread: gE mediates retrograde spread of the virus from epithelial cells to neurites, which is important for establishing latent infection in sensory ganglia .

What proteins interact with gE during the viral life cycle?

Glycoprotein E participates in a network of protein-protein interactions that are critical for its function:

Interacting ProteinType of InteractionFunctional Significance
UL11Direct complex formation with gE cytoplasmic tailCritical for gE processing, transport, and biological activity
UL16Interaction with gE, becomes efficient when other binding partners are presentPart of coordinated assembly that regulates gE function
UL21Forms complex with gE, UL11, and UL16Required for proper functioning of gE in cell-to-cell spread
gIForms functional heterodimer with gESorts nascent virions to epithelial cell junctions

Research by Maringer et al. has demonstrated that tegument proteins UL11, UL16, and UL21 come together with very high efficiency to form a complex with gE in transfected cells in a regulated and coordinated manner . Notably, the interaction of UL16 with membrane proteins (UL11 and gE), which is inefficient in pairwise transfections, becomes efficient when other binding partners are present, suggesting a coordinated assembly process .

How do tegument proteins UL11, UL16, and UL21 modulate gE function?

The tegument proteins UL11, UL16, and UL21 collectively modulate gE function through a sophisticated interaction network:

  • Complex formation: These three tegument proteins assemble on the cytoplasmic tail of gE to form a highly efficient complex in vivo . This assembly occurs in a coordinated manner, with the presence of certain components enhancing the interaction efficiency of others.

  • Processing regulation: Studies of viral mutants have revealed that each of these tegument proteins is critical for the proper processing of gE . In the absence of UL11, UL16, or UL21, gE processing is compromised, affecting its functional capacity.

  • Transport facilitation: The tegument protein complex plays an essential role in the transport of gE within infected cells, ensuring that it reaches the appropriate cellular compartments for viral assembly and budding .

  • Biological activity: The function of gE in processes such as cell-to-cell spread and virus-induced cell fusion requires the cooperation of UL11, UL16, and UL21 . Without these tegument proteins, gE's biological activity is significantly reduced.

The significance of these interactions was revealed through studies of viral mutants, which demonstrated that each of these tegument proteins is critical for the processing, transport, and biological activity of gE . This finding has important implications for understanding HSV assembly and budding mechanisms.

What experimental approaches are most effective for studying gE-protein interactions?

Several experimental approaches have proven effective for investigating gE-protein interactions:

  • Transfection studies with co-immunoprecipitation: This approach involves co-transfecting cells with plasmids encoding gE and its potential interaction partners, followed by co-immunoprecipitation to detect protein complexes. This method was successfully used to demonstrate the complex formation between gE, UL11, UL16, and UL21, revealing that these proteins come together with high efficiency to form a complex in transfected cells .

  • Viral mutagenesis: Generating HSV-1 mutants with deletions or modifications in gE or its interaction partners can reveal the functional significance of specific interactions. Studies with viral mutants have confirmed that tegument proteins UL11, UL16, and UL21 are critical for the proper functioning of gE .

  • Biochemical analysis of protein complexes: Techniques such as size exclusion chromatography, chemical crosslinking, and mass spectrometry can be used to characterize the composition and stoichiometry of gE-containing protein complexes.

  • Fluorescence microscopy: Using fluorescently tagged versions of gE and its interaction partners can enable visualization of protein localization and co-localization in living cells.

  • Structural biology approaches: X-ray crystallography and cryo-electron microscopy can provide detailed information about the three-dimensional structure of gE alone or in complex with its interaction partners.

When designing experiments to study gE-protein interactions, it is important to consider the coordinated nature of these interactions, as the efficiency of certain interactions (e.g., UL16 with gE) significantly increases when other binding partners are present .

How can recombinant gE be engineered for targeted viral tropism?

Engineering recombinant gE for targeted viral tropism requires strategic modifications while preserving essential functions:

  • Domain identification: First, researchers must identify which domains of gE can be modified without disrupting its core functions in viral assembly and spread. Understanding the structure-function relationship is critical for successful engineering.

  • Targeting strategies: Several approaches can be employed:

    a. Domain replacement: Critical domains of gE can be replaced with ligands that bind to specific cell surface receptors, redirecting viral tropism to cells expressing those receptors.

    b. Addition of targeting motifs: Ligands or antibody fragments can be fused to gE to create chimeric proteins that retain gE function while gaining new receptor specificity.

  • Complementary modifications: For optimal targeting, modifications to gE should be accompanied by alterations to other envelope glycoproteins involved in cell attachment and entry.

Although the search results don't provide specific examples of engineering gE for targeted tropism, they describe a related approach with glycoprotein C (gC). Researchers created a recombinant HSV-1 in which the heparan sulfate binding domain of gC was replaced with erythropoietin (EPO), resulting in a virus that could bind to cells expressing the EPO receptor . This recombinant virus (KgBpK−gCEPO2) was specifically retained on a soluble EPO receptor column, was neutralized by soluble EPO receptor, and stimulated proliferation of EPO growth-dependent cells .

A similar strategy could potentially be applied to gE, though researchers must consider that modifications may affect protein processing, transport, and incorporation into the viral envelope.

What are the methodological challenges in expressing functional recombinant HSV-1 gE?

Expressing functional recombinant HSV-1 gE presents several methodological challenges:

  • Preserving protein folding and conformation: Modifications to gE may disrupt its proper folding, leading to non-functional protein. Research has shown that modifications of HSV glycoproteins can result in defective recombinant molecule processing and/or intracellular trafficking, consequently leading to failure in incorporating the modified protein into virus envelopes .

  • Post-translational modification requirements: gE undergoes complex post-translational modifications that are essential for its function. The expression system must be capable of performing these modifications correctly, typically necessitating mammalian cell-based expression systems.

  • Maintaining critical protein-protein interactions: As demonstrated by Maringer et al., gE functions through interactions with multiple partners, including tegument proteins UL11, UL16, and UL21 . Recombinant versions must preserve these interaction capabilities.

  • Ensuring proper protein transport: Changes to gE may affect its transport to the cell surface and incorporation into virions. When engineering recombinant gE, researchers must verify that the modified protein is properly transported to the cell surface and can be incorporated into the viral envelope.

  • Expression level optimization: Over-expression or under-expression of recombinant gE can lead to artifacts or insufficient protein for analysis. Expression levels should be carefully controlled, potentially using inducible expression systems.

  • Selection of appropriate cellular context: The functionality of recombinant gE may depend on the cellular context in which it is expressed, particularly given the importance of cell-type specific factors in gE processing and function.

How does gE contribute to neuronal infection and retrograde transport of HSV-1?

Glycoprotein E plays critical roles in neuronal infection and retrograde transport of HSV-1:

  • Axonal localization: Research has demonstrated that gE is required for the axonal localization of viral capsid, tegument, and membrane glycoproteins, which is essential for neuronal infection . Without gE, viral components fail to properly localize within neuronal axons, significantly impairing neuronal infection.

  • Retrograde transport: gE mediates retrograde spread of HSV-1 from epithelial cells to neurites, facilitating the establishment of infection in neurons following initial infection at epithelial surfaces . This function is crucial for the virus's ability to reach and establish latency in sensory ganglia.

  • Neuron-specific functions: The role of gE in neurons appears to be distinct from its function in epithelial cells, reflecting specializations for neuronal infection and transport. Studies have shown that HSV-2 gE is required for targeting viral proteins from the neuron cell body into axons, indicating a crucial role in axonal transport .

  • Interaction with neuronal transport machinery: Although not explicitly detailed in the search results, gE likely interacts with components of the neuronal transport machinery to facilitate movement of viral particles along axons.

These neuronal-specific functions of gE highlight the sophisticated adaptations of HSV-1 for neuroinvasion and establish gE as a potential target for interventions aimed at preventing neurological complications of HSV infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.