Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG)-VLPs

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Herpesvirus 1 Envelope Glycoprotein G (gG)-VLPs

Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG)-VLPs are engineered structures designed to mimic viral particles while incorporating the gG protein from herpes simplex virus type 1 (HSV-1). These VLPs (Virus-Like Particles) lack genomic material, making them safe for research and therapeutic applications. The gG protein, encoded by the HSV-1 US4 gene, is critical for viral entry and immune evasion . By integrating this protein into VLPs, researchers aim to leverage its immunogenic properties for serodiagnosis, vaccine development, and studies of viral pathogenesis.

Comparative Analysis of VLP Platforms

The table below contrasts gG-VLPs with established VLP systems, highlighting their unique advantages:

VLP TypeAntigenPlatformKey ApplicationsImmune Response
HSV-1 gG-VLPsgG (US4)Lipid nanoparticlesHSV-1 serodiagnosis, vaccinesNeutralizing antibodies, TH1
HIV gp120-VLPsHIV-1 envelopeSf9 insect cellsHIV vaccine developmentBroad neutralizing responses
HBV HBsAg-VLPsHepatitis B surfacePichia pastorisHepatitis B vaccinesStrong IgG and IgA responses

Data adapted from and analogous systems.

Future Directions

  • Optimized Formulations: Testing gG-VLPs in combination with adjuvants or other viral antigens (e.g., gD) to broaden immune coverage.

  • Clinical Translation: Leveraging VLP scalability for large-scale production of HSV-1 diagnostic kits or prophylactic vaccines.

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal blue ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance. Extra fees for dry ice and a dry ice box will be charged.
Lead Time
Delivery time may differ depending on the purchasing method or location. Please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ depending on the purchasing method or location. Please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you have a specific tag type in mind, please inform us, and we will check if it is feasible to develop.
Synonyms
gG; US4; Envelope glycoprotein G; gG; gG-1
Datasheet & Coa
Please contact us to get it.
Expression Region
25-238aa
Research Area
Microbiology
Source
Mammalian cell
Species
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Target Names
gG
Target Protein Sequence
VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Chemokine-binding protein that inhibits neutrophils' chemotaxis.
Gene References Into Functions
  1. HSV-1 Us3 is a multifunctional protein that plays various roles in the viral life cycle by phosphorylating a number of viral and cellular substrates. [review] PMID: 29896662
  2. It regulates the pathogenicity of herpes simplex virus type-1 PMID: 28484184
  3. This study identifies the alphaherpesvirus-specific Us3 kinase as an mTORC1 activator that subverts the host cell energy-sensing program to support viral productive growth irrespective of physiological stress. PMID: 28468873
  4. Findings show that Us8A is a virulence factor for HSV-1 infection in mice, and the function of Us8A for viral invasion into the central nervous system from peripheral sites is regulated by Us3-mediated phosphorylation of the protein at Ser-61. PMID: 27030266
  5. The difference between HSV-1 and HSV-2 Us3 kinases appeared to be due to the fact that some Us3 phosphorylation sites in HSV-1 proteins are not conserved in the corresponding HSV-2 proteins. PMID: 26491159
  6. Us3 enables the nucleus to cytoplasm capsid translocation. Nevertheless, Us3 is not essential for the production of infective progeny viruses. PMID: 25588052
  7. HSV-1-encoded Us3 protein interrupted TCR signaling and interleukin-2 production by inactivation of the linker for activation of T cells. PMID: 25907557
  8. Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression. PMID: 25878107
  9. This study demonstrated that herpes simplex virus 1 protein kinase US3 significantly inhibited NF-kappaB activation via hyperphosphorylation of p65 and decreased the expression of inflammatory chemokine interleukin-8 (IL-8). PMID: 24807716
  10. Sufficient dUTPase activity was required for efficient herpes simplex virus 1 replication and Us3 phosphorylation of viral dUTPase Ser-187 upregulated dUTPase activity in host cells with low cellular dUTPase activity. PMID: 24760895
  11. STING is stable in cancer-derived HEp-2 or HeLa cells infected with wild-type HSV-1 but is degraded in cells infected with mutants lacking the genes encoding functional infected cell protein 0 (ICP0), ICP4, or the US3 protein kinase PMID: 24449861
  12. Herpes simplex virus 1 US3 hyperphosphorylates IRF3 and inhibits beta interferon production. PMID: 24049179
  13. Human herpesvirus 1 US3 is necessary and sufficient for inhibiting TLR2 signaling at or before the stage of TRAF6 ubiquitination. PMID: 23478027
  14. US3 plays a significant role in down-regulation of membrane biosynthesis. PMID: 22789738
  15. These results suggested that Us3 phosphorylation of UL47 Ser-77 promoted the nuclear localization of UL47 in cell cultures and played a critical role in viral replication and pathogenesis in vivo. PMID: 21734045
  16. Identified gB and US3 as two viral factors that together downregulate CD1d surface expression; results suggest that HSV-1 uses gB and US3 to rapidly inhibit NKT cell function in the initial antiviral response PMID: 21653669
  17. The authors demonstrated that Us3 phosphorylation of glycoprotein B Thr-887 upregulated the accumulation of endocytosed of glycoprotein B from the surfaces of infected cells. PMID: 21389132
  18. Us3 is an Akt surrogate with overlapping substrate specificity to activate mTORC1, stimulating translation and virus replication PMID: 21123650
  19. Us3 phosphorylation of gB Thr-887 played a critical role in viral replication in vivo and in HSV-1 pathogenesis PMID: 19846518
  20. This prostein accumulates in cells infected with the mutant lacking the gene encoding ICP22 mediated the phosphorylation of histone deacetylase. PMID: 15956590
  21. U(S)3 and U(S)3.5 protein kinases of herpes simplex virus 1 differ with respect to their functions in blocking apoptosis and in virion maturation and egress. PMID: 16571792
  22. U(S)3 protein kinase blocks histone deacetylation by a mechanism distinct from that of ICP0. PMID: 16785443
  23. It was concluded that US3 was mediating the suppression of mitochondrial respiration following HHV-1 infection. PMID: 16847111
  24. Us3, Us5, and Us12 viral genes each have unique inhibitory effects on the different T lymphocyte cytotoxic effects PMID: 16987059
  25. US3 blocks the proteolytic cleavage that generates active caspase 3 from the transfected zymogen procaspase 3, concomitant with inhibition of apoptosis. PMID: 17634220
  26. These results supported the hypothesis that Us3 phosphorylates gB and downregulates the cell surface expression of gB in HSV-1-infected cells. PMID: 18945776
  27. The majority of the US3-dependent phosphorylation of gB involved the CT domain and amino acid T887, a residue present in a motif similar to that recognized by US3 in other proteins. PMID: 19158241
  28. US3-mediated phosphorylation of UL31 is critical to regulate nuclear egress. PMID: 19279109
  29. Regulation of Us3 activity by autophosphorylation appeared to play a critical role in viral replication in vivo and in HSV-1 pathogenesis PMID: 19297494
  30. Regulatory and functional effects differ from Us3 protein kinase in herpes simplex virus 2 PMID: 19740999

Show More

Hide All

Database Links

KEGG: vg:2703404

Protein Families
Alphaherpesvirinae glycoprotein G family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.