Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG)

Shipped with Ice Packs
In Stock

Description

Chemokine Binding and Immune Evasion

gG acts as a viral chemokine-binding protein (vCKBP) with dual roles:

FunctionMechanismImpact
Chemokine inhibitionBinds IL-8 and other chemokines, blocking neutrophil migration Reduces immune cell recruitment to infection sites
Chemokine enhancementStabilizes chemokine/GAG complexes, increasing CXCR4 clustering and signaling Enhances viral spread in immune-privileged sites

Studies using recombinant gG demonstrated a 78% reduction in IL-8-induced neutrophil chemotaxis at concentrations ≥0.6 μg/ml . Paradoxically, gG also amplifies chemokine responses by promoting nanoclustering of chemokine receptors, suggesting context-dependent roles .

Genetic Variability

Sequencing of 108 clinical HSV-1 isolates revealed two primary gG variants:

VariantFrequencyMAb ReactivityKey Mutation
Syn17-like62%PositiveV113 preserved
KOS321-like38%NegativeV113→I substitution

Four strains showed recombination between these variants, and one harbored a frameshift mutation causing gG truncation . Despite variability, recombinant gG-based ELISAs maintained diagnostic accuracy across variants .

Role in Viral Pathogenesis

  • Neuronal spread: HSV-1 gG modifies extracellular vesicles (EVs) to increase galectin-1 content, promoting neurite outgrowth and facilitating neuronal infection .

  • Tissue tropism: gG-deficient HSV-1 (ΔgG) exhibits 100-fold reduced apical infectivity in polarized MDCK cells compared to wild-type .

Diagnostic and Research Applications

Recombinant gG is widely used in:

  • Type-specific serology: IgG detection ELISAs show 98% concordance with whole-virus assays .

  • Vaccine development: GST-tagged gG fragments induce gG-specific IgG and CD8+ T cells in murine models .

  • Mechanistic studies: Purified gG enables functional assays without biosafety constraints .

Production and Quality Control

ParameterSpecification
Expression systemE. coli (e.g., pGEX-4T-1 vector)
Purity>90% (SDS-PAGE)
TagsN-terminal 6xHis-SUMO
StabilityLyophilized or liquid; -80°C storage

Commercial variants (e.g., ab43048) are validated for Western blot and ELISA, with batch-specific activity certifications .

Challenges and Future Directions

  • Strain variability: Mismatches between vaccine/diagnostic gG and circulating strains necessitate periodic sequence surveillance .

  • Therapeutic potential: While gG’s immunomodulatory properties are promising, current recombinants are labeled "For research use only" due to uncharacterized off-target effects .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based solution containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which you may use as a reference point.
Shelf Life
The shelf life of this product is influenced by several factors, including the storage state, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
gG; US4; Envelope glycoprotein G; gG; gG-1
Datasheet & Coa
Please contact us to get it.
Expression Region
25-238aa
Mol. Weight
28.8 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Microbiology
Source
in vitro E.coli expression system
Species
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Target Names
gG
Target Protein Sequence
VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Chemokine-binding protein that inhibits neutrophils' chemotaxis.
Gene References Into Functions
  1. HSV-1 Us3 is a multifunctional protein that plays a significant role in the viral life cycle by phosphorylating various viral and cellular substrates. [review] PMID: 29896662
  2. It regulates the pathogenicity of herpes simplex virus type-1 PMID: 28484184
  3. This study identifies the alphaherpesvirus-specific Us3 kinase as an mTORC1 activator, which subverts the host cell's energy-sensing program to support productive viral growth, irrespective of physiological stress. PMID: 28468873
  4. findings reveal that Us8A is a virulence factor for HSV-1 infection in mice. The function of Us8A for viral invasion into the central nervous system from peripheral sites is regulated by Us3-mediated phosphorylation of the protein at Ser-61. PMID: 27030266
  5. The observed difference between HSV-1 and HSV-2 Us3 kinases appears to stem from the fact that certain Us3 phosphorylation sites in HSV-1 proteins are not conserved in the corresponding HSV-2 proteins. PMID: 26491159
  6. Us3 facilitates the nucleus to cytoplasm capsid translocation. However, Us3 is not essential for the production of infectious progeny viruses. PMID: 25588052
  7. HSV-1-encoded Us3 protein interrupts TCR signaling and interleukin-2 production by inactivating the linker for activation of T cells. PMID: 25907557
  8. Ablation of this phosphorylation eliminates herpes simplex virus 1 US3-mediated downregulation of CD1d expression, indicating that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression. PMID: 25878107
  9. This study demonstrates that herpes simplex virus 1 protein kinase US3 significantly inhibits NF-kappaB activation via hyperphosphorylation of p65 and decreases the expression of inflammatory chemokine interleukin-8 (IL-8). PMID: 24807716
  10. Adequate dUTPase activity is necessary for efficient herpes simplex virus 1 replication. Us3 phosphorylation of viral dUTPase Ser-187 upregulates dUTPase activity in host cells with low cellular dUTPase activity. PMID: 24760895
  11. STING remains stable in cancer-derived HEp-2 or HeLa cells infected with wild-type HSV-1, but undergoes degradation in cells infected with mutants lacking the genes encoding functional infected cell protein 0 (ICP0), ICP4, or the US3 protein kinase. PMID: 24449861
  12. Herpes simplex virus 1 US3 hyperphosphorylates IRF3 and inhibits beta interferon production. PMID: 24049179
  13. Human herpesvirus 1 US3 is necessary and sufficient for inhibiting TLR2 signaling at or before the stage of TRAF6 ubiquitination. PMID: 23478027
  14. US3 plays a significant role in the downregulation of membrane biosynthesis. PMID: 22789738
  15. These results suggest that Us3 phosphorylation of UL47 Ser-77 promotes the nuclear localization of UL47 in cell cultures and plays a critical role in viral replication and pathogenesis in vivo. PMID: 21734045
  16. The research identified gB and US3 as two viral factors that collaboratively downregulate CD1d surface expression. Findings indicate that HSV-1 utilizes gB and US3 to rapidly inhibit NKT cell function during the initial antiviral response. PMID: 21653669
  17. The authors demonstrated that Us3 phosphorylation of glycoprotein B Thr-887 upregulates the accumulation of endocytosed glycoprotein B from the surfaces of infected cells. PMID: 21389132
  18. Us3 functions as an Akt surrogate with overlapping substrate specificity to activate mTORC1, thereby stimulating translation and virus replication. PMID: 21123650
  19. Us3 phosphorylation of gB Thr-887 plays a crucial role in viral replication in vivo and in HSV-1 pathogenesis. PMID: 19846518
  20. This protein accumulates in cells infected with the mutant lacking the gene encoding ICP22, mediating the phosphorylation of histone deacetylase. PMID: 15956590
  21. U(S)3 and U(S)3.5 protein kinases of herpes simplex virus 1 differ in their respective functions in blocking apoptosis, virion maturation, and egress. PMID: 16571792
  22. U(S)3 protein kinase blocks histone deacetylation through a mechanism distinct from that of ICP0. PMID: 16785443
  23. It was concluded that US3 mediates the suppression of mitochondrial respiration following HHV-1 infection. PMID: 16847111
  24. Us3, Us5, and Us12 viral genes each exert unique inhibitory effects on different T lymphocyte cytotoxic effects. PMID: 16987059
  25. US3 blocks the proteolytic cleavage that generates active caspase 3 from the transfected zymogen procaspase 3, concurrently inhibiting apoptosis. PMID: 17634220
  26. These results support the hypothesis that Us3 phosphorylates gB and downregulates the cell surface expression of gB in HSV-1-infected cells. PMID: 18945776
  27. The majority of US3-dependent phosphorylation of gB involves the CT domain and amino acid T887, a residue present in a motif similar to that recognized by US3 in other proteins. PMID: 19158241
  28. US3-mediated phosphorylation of UL31 is essential for regulating nuclear egress. PMID: 19279109
  29. Regulation of Us3 activity by autophosphorylation appears to play a critical role in viral replication in vivo and in HSV-1 pathogenesis. PMID: 19297494
  30. Regulatory and functional effects differ from Us3 protein kinase in herpes simplex virus 2. PMID: 19740999

Show More

Hide All

Database Links

KEGG: vg:2703404

Protein Families
Alphaherpesvirinae glycoprotein G family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the genomic origin and structural characteristics of HSV-1 glycoprotein G?

Glycoprotein G (gG) of Human herpesvirus 1 (HHV-1/HSV-1) is encoded by the US4 gene. It plays crucial roles in the viral life cycle, particularly in cell entry mechanisms and immune evasion strategies . The recombinant form typically spans the 25-189 amino acid expression region when produced in expression systems like E. coli .

In its native context, gG functions as part of the complex viral envelope structure that facilitates interactions with host cell receptors. While not as extensively characterized as some other HSV-1 glycoproteins, gG contributes to the virus's ability to establish infection and modulate host immune responses.

How does glycoprotein G function in comparison to other HSV-1 envelope glycoproteins?

Glycoprotein G functions distinctly from other major HSV-1 envelope glycoproteins. Unlike glycoprotein B (gB), which serves as a class III membrane fusion protein combining features of class I and II fusion proteins, or glycoprotein D (gD), which directly engages with cellular receptors like HVEM and nectin-1, gG plays more specialized roles in immune modulation and viral tropism .

The functional hierarchy among HSV-1 glycoproteins places gB, gD, and the gH/gL complex as the core components of the "fusion machine" that mediates viral entry . Glycoprotein G contributes to viral pathogenesis through complementary mechanisms, including:

  • Modulation of chemokine activity

  • Alteration of host immune cell migration

  • Contribution to viral tropism in specific tissues

  • Potential roles in viral release from infected cells

This functional differentiation is important for researchers designing experiments targeting specific aspects of the viral life cycle.

What expression systems are optimal for producing recombinant HSV-1 glycoprotein G?

For producing recombinant HSV-1 glycoprotein G, E. coli expression systems have been established as effective platforms. These systems typically incorporate specific tags (such as 6xHis-SUMO tags) to facilitate protein purification and detection processes . When designing an expression strategy, researchers should consider:

Expression SystemAdvantagesLimitationsTypical YieldApplications
E. coliCost-effective, rapid production, high yieldsLimited post-translational modifications>90% purity with optimizationWestern blot, ELISA, antibody production
Mammalian cellsNative-like glycosylation, proper foldingHigher cost, slower productionModerate yield with authentic modificationsFunctional studies, neutralization assays
Baculovirus/insect cellsIntermediate complexity modifications, scalableRequires specialized expertiseGood balance of yield and qualityStructural studies, complex formation

For research requiring faithful representation of glycosylation patterns, mammalian expression systems may be preferable despite lower yields, while E. coli systems producing protein with >90% purity (as determined by SDS-PAGE) provide abundant material for many applications .

What purification strategies are most effective for recombinant glycoprotein G?

Purification of recombinant glycoprotein G typically employs affinity chromatography approaches that leverage engineered tags. The N-terminal 6xHis-SUMO tag is particularly effective for streamlined purification processes . A comprehensive purification protocol would include:

  • Initial capture using immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Optional SUMO protease treatment to remove the tag if native protein is required

  • Size exclusion chromatography for further purification and buffer exchange

  • Quality control assessment via SDS-PAGE to confirm >90% purity

For applications requiring exceptionally pure material, additional ion exchange chromatography steps may be incorporated. The final product can be prepared in either liquid form or as a lyophilized powder, providing flexibility for various experimental applications .

How can recombinant glycoprotein G be effectively used in serological diagnostics?

Recombinant glycoprotein G represents a valuable tool for developing serological diagnostics for HSV-1 infections. Research indicates that gG can induce significant antibody production in infected individuals, making it useful for antibody detection assays . When implementing gG-based diagnostics, researchers should consider:

  • Western blot applications using purified recombinant gG for detection of anti-HSV-1 antibodies

  • ELISA configurations optimized for sensitivity and specificity

  • Potential cross-reactivity considerations with HSV-2

Studies comparing antibody responses to different HSV-1 glycoproteins have shown that while total gD antibody titers are higher than gG antibody titers in HSV-1 infected patients' sera, the gG antibody response remains significant and diagnostically valuable . A strategic approach often combines both glycoproteins in diagnostic panels for comprehensive antibody profiling.

What are the methodological considerations for using recombinant glycoprotein G in antibody specificity studies?

When conducting antibody specificity studies using recombinant glycoprotein G, researchers must address several methodological considerations:

  • Antigen preparation: Ensure recombinant gG retains critical epitopes by verifying protein folding and confirmation

  • Cross-reactivity control: Include parallel testing with HSV-2 glycoproteins to evaluate specificity

  • Sample preparation: Optimize serum dilutions and blocking conditions to minimize background

  • Detection systems: Select appropriate secondary antibodies or conjugates for the detection system

  • Validation: Incorporate known positive and negative controls to establish assay parameters

Research has demonstrated that properly designed assays using recombinant gG can distinguish between antibody responses to HSV-1 and HSV-2, making this approach valuable for type-specific serological testing . The western blot technique has proven particularly effective for this application, with appropriate controls for validation.

How can glycoprotein G be engineered for viral tropism modification studies?

Engineering glycoprotein G for viral tropism modification represents an advanced research application with significant implications for targeted therapeutics and vaccine development. Drawing from approaches used with other HSV glycoproteins, researchers can:

  • Design chimeric constructs combining functional domains of gG with targeting ligands

  • Create deletion mutants to identify essential regions for native function

  • Incorporate heterologous receptor-binding domains to redirect viral tropism

  • Develop complementation systems to assess functionality in trans

This approach builds on established techniques where researchers have successfully created chimeric proteins composed of truncated viral glycoproteins fused to targeting molecules like erythropoietin hormone (EPO) . While specific examples with gG are less documented than with glycoprotein C, the principles established with gC engineering provide a methodological framework applicable to gG studies.

What are the challenges and solutions for structural characterization of recombinant glycoprotein G?

Structural characterization of recombinant glycoprotein G presents several technical challenges that researchers must address:

ChallengeTechnical ApproachAnalytical MethodConsiderations
Protein solubilityOptimization of buffer conditionsDynamic light scatteringpH, ionic strength, detergents for membrane proteins
Glycosylation heterogeneityExpression system selectionMass spectrometryE. coli vs. mammalian expression trade-offs
Conformational integrityCircular dichroism spectroscopySecondary structure analysisNative vs. denatured state comparison
Crystal formationScreening crystallization conditionsX-ray crystallographyProtein concentration, precipitants, temperature
Membrane associationNanodiscs or detergent micellesCryo-electron microscopyLipid composition, protein-lipid interactions

Researchers have successfully addressed similar challenges with other HSV glycoproteins by employing E. coli expression systems producing truncated forms with >90% purity suitable for structural and biochemical analyses . When glycosylation is critical, alternative expression systems may be required despite potential yield reductions.

How does glycoprotein G contribute to immune evasion, and how can this be studied?

Glycoprotein G contributes to HSV-1 immune evasion through multiple mechanisms that can be investigated using recombinant protein preparations. Research methodologies should address:

  • Chemokine binding assays to assess gG's ability to disrupt immune cell recruitment

  • Functional immunomodulation studies examining effects on dendritic cell maturation

  • Complement interaction analysis to determine interference with complement activation

  • Antibody escape variant analysis through sequential serum samples

Immunological research has established that envelope glycoproteins, including gG, play crucial roles in viral immune evasion strategies . Experiments using purified recombinant gG can isolate specific immunomodulatory functions from the context of whole virus infection, allowing precise mechanism determination.

What methodologies are most effective for analyzing the neutralizing antibody response to glycoprotein G?

Analysis of neutralizing antibody responses to glycoprotein G requires specialized methodologies:

  • Virus neutralization assays: Compare wild-type virus with gG-deleted mutants to assess contribution to neutralization

  • Epitope mapping: Use peptide arrays or alanine scanning mutagenesis to identify neutralizing epitopes

  • Competition assays: Determine if anti-gG antibodies compete with receptor binding

  • Pseudotyped particle systems: Develop surrogate systems expressing gG for high-throughput screening

Research has demonstrated that antibodies against HSV-1 glycoproteins, including gG, can be detected and characterized through western blot tests and other immunoassays . While gD typically elicits higher antibody titers, the gG-specific response remains significant and analytically meaningful. Comparative analysis of antibody responses to multiple glycoproteins provides the most comprehensive assessment of immunity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.