Recombinant Human herpesvirus 1 Envelope glycoprotein I (gI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gI; US7; Envelope glycoprotein I; gI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-390
Protein Length
full length protein
Species
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Target Names
gI
Target Protein Sequence
LVVRGPTVSLVSNSFVDAGALGPDGVVEEDLLILGELRFVGDQVPHTTYYDGGVELWHYP MGHKCPRVVHVVTVTACPRRPAVAFALCRATDSTHSPAYPTLELNLAQQPLLRVQRATRD YAGVYVLRVWVGDAPNASLFVLGMAIAAEGTLAYNGSAYGSCDPKLLPSSAPRLAPASVY QPAPNQASTPSTTTSTPSTTIPAPSTTIPAPQASTTPFPTGDPKPQPPGVNHEPPSNATR ATRDSRYALTVTQIIQIAIPASIIALVFLGSCICFIHRCQRRYRRSRRPIYSPQMPTGIS CAVNEAAMARLGAELKSHPSTPPKSRRRSSRTPMPSLTAIAEESEPAGAAGLPTPPVDPT TPTPTPPLLV
Uniprot No.

Target Background

Function
In epithelial cells, the gE/gI heterodimer is essential for cell-to-cell viral spread. It facilitates the targeting of nascent virions to cell junctions, enabling rapid spread to adjacent cells via interactions with junctional receptors. This process is implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is crucial for anterograde viral spread throughout the nervous system. In conjunction with US9, gE/gI participates in the sorting and axonal transport of viral components. Furthermore, the gE/gI heterodimer acts as a receptor for the Fc region of human IgG, dissociating at acidic pH. This interaction may interfere with host antibody-mediated immune responses through bipolar bridging, followed by intracellular endocytosis and degradation.
Gene References Into Functions
  1. gE/gI and US9 cooperatively function in neuronal cell bodies to facilitate the loading of capsids and glycoprotein-containing vesicles onto microtubule motors, enabling transport towards axon terminals. PMID: 23077321
  2. gE/gI and US9 promote the loading of capsids and glycoprotein vesicles onto microtubule motors within the neuronal cell body, transporting HSV components to axon terminals. PMID: 18753205
  3. gE and gI are essential for HSV-1 anterograde spread, while Us9 is dispensable. PMID: 19570876
Database Links

KEGG: vg:2703446

Protein Families
Alphaherpesvirinae glycoprotein I family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus, host trans-Golgi network.

Q&A

What is the genomic location and structure of HSV-1 glycoprotein I?

Glycoprotein I (gI) is encoded in the unique short (US) region of the HSV-1 genome, alongside other important glycoproteins like gG and gE. The gI gene contains polymorphic tandem repeat regions, consisting of two to eight blocks of 21 nucleotides, which can vary between different viral isolates . As one of the 12 envelope glycoproteins encoded by HSV-1, gI features an extracellular domain, a transmembrane region, and an intracellular portion . Notably, some laboratory strains such as KOS321 display frameshift mutations in the gI gene that alter the intracellular portion of the protein, which should be considered when selecting strains for research purposes .

How does glycoprotein I contribute to HSV-1 infectivity?

Like other HSV-1 envelope glycoproteins, gI participates in the viral life cycle by mediating specific aspects of infection. While glycoproteins gB, gD, and gH/gL are primarily involved in receptor binding and membrane fusion during viral entry, gI primarily functions in complex with glycoprotein E (gE) . This gE-gI complex plays crucial roles in cell-to-cell spread of the virus within tissues and contributes to immune evasion by functioning as an Fc receptor that binds the Fc portion of host IgG antibodies. This Fc receptor activity potentially shields the virus from antibody-mediated neutralization through a mechanism similar to that observed with gC shielding gD from neutralizing antibodies .

What post-translational modifications are important for glycoprotein I function?

Both N-linked and O-linked glycosylation are critical for the proper function of HSV-1 envelope glycoproteins. Recent proteome-wide studies have identified numerous O-glycosylation sites on HSV-1 envelope proteins, highlighting their functional importance . While the specific O-glycosylation sites on gI have not been comprehensively mapped in the provided search results, studies using genetically engineered keratinocytes lacking O-glycan elongation capacity have demonstrated that O-linked glycans significantly impact HSV-1 infectivity, as viruses produced in these cells showed reduced titers compared to those from wild-type cells . Research methodologies for mapping these modifications include sophisticated mass spectrometry approaches that can identify site-specific glycosylation patterns.

What expression systems are optimal for producing recombinant HSV-1 glycoprotein I?

The choice of expression system for recombinant gI production depends on research objectives and required post-translational modifications. Based on approaches used for other HSV-1 glycoproteins, researchers can utilize bacterial systems like E. coli (typically with fusion tags such as 6xHis-SUMO for purification), which provide high yields but lack glycosylation capacity . For applications requiring native glycosylation patterns, eukaryotic expression systems are preferable, including:

  • Mammalian cell lines (HEK293, CHO cells) for authentic glycosylation

  • Insect cells with baculovirus vectors for high-yield production with partial glycosylation

  • Yeast systems as a compromise between yield and post-translational processing

When designing expression constructs, researchers should consider including affinity tags for purification while ensuring these additions don't interfere with the protein's structural integrity or function.

What purification strategies yield the highest quality recombinant glycoprotein I preparations?

A multi-step purification strategy typically yields the highest quality recombinant gI preparations:

  • Initial capture using affinity chromatography (e.g., Ni-NTA for His-tagged constructs)

  • Intermediate purification via ion exchange chromatography to separate differentially charged species

  • Final polishing using size exclusion chromatography to ensure homogeneity

For membrane-associated constructs containing the transmembrane domain, detergent selection is critical—mild non-ionic detergents like DDM or LMNG often preserve structure while solubilizing the protein. Quality assessment should include SDS-PAGE (>90% purity standard), Western blotting, mass spectrometry for identity confirmation, and functional assays to verify activity . For structural biology applications, additional biophysical characterization via circular dichroism or dynamic light scattering is recommended to assess proper folding and monodispersity.

How can researchers verify the proper folding and functionality of recombinant glycoprotein I?

Verification of proper folding and functionality requires a combination of biophysical and functional approaches:

Biophysical Characterization:

  • Circular dichroism spectroscopy to assess secondary structure elements

  • Thermal shift assays to evaluate stability and proper folding

  • Size exclusion chromatography to confirm appropriate oligomeric state

  • Limited proteolysis to probe for compact, folded domains

Functional Verification:

  • Complex formation assays with recombinant gE to confirm interaction capability

  • Fc binding assays to verify the Fc receptor function of the gE-gI complex

  • Cell binding assays to assess native-like surface interactions

  • Antibody recognition using conformation-specific antibodies

The combination of these approaches provides comprehensive evidence for proper folding and function of recombinant gI preparations before their application in more complex experimental systems.

How diverse are glycoprotein I sequences across clinical HSV-1 isolates?

Analysis of sequence diversity in HSV-1 gI reveals important patterns relevant to both basic virology and translational applications. Studies examining glycoprotein-encoding genes in the US region have identified three distinct genetic groups among clinical HSV-1 isolates . The gI gene contains polymorphic tandem repeat regions (two to eight blocks of 21 nucleotides) that contribute significantly to this diversity . This variation is not evenly distributed across the protein—certain domains show higher conservation (likely functionally constrained regions) while others demonstrate greater variability.

The phylogenetic relationships between gI sequences from different geographic regions show patterns of both divergent evolution and evidence of recombination. When analyzing gI sequences, researchers should consider:

  • Geographic origin of isolates (European, Asian, African, and North American strains show distinct patterns)

  • Clinical manifestation associated with the isolate (oral, genital, or encephalitic)

  • Presence of signature polymorphisms that may define functional variants

Recent full-genome sequencing efforts have expanded our understanding of global HSV-1 diversity, providing valuable datasets for comparative glycoprotein analysis .

What evidence exists for recombination involving the glycoprotein I gene?

Substantial evidence indicates that recombination events involving the US region, where the gI gene resides, are common in HSV-1. Phylogenetic analysis of clinical isolates has revealed that many strains display sequence patterns consistent with both intergenic and intragenic recombination . Specific nucleotide substitutions can serve as recombination markers, allowing researchers to identify where sequence exchange has occurred.

In one study examining the US region (including gI), seven out of 28 clinical isolates displayed evidence of intergenic recombination, while at least four showed intragenic recombination patterns . This high frequency of recombination suggests that most full-length HSV-1 genomes likely represent mosaics of segments from different genetic groups. Methodologically, this presents challenges for phylogenetic analysis and requires specialized approaches:

  • Bootscanning and similarity plotting to identify potential recombination breakpoints

  • Maximum likelihood methods with appropriate evolutionary models

  • Split decomposition analysis to visualize conflicting phylogenetic signals

  • Bayesian inference approaches that can accommodate recombination

Understanding these recombination events is crucial for vaccine development, molecular epidemiology, and interpretation of evolutionary patterns in HSV-1.

How do structural polymorphisms in glycoprotein I correlate with viral phenotypes?

While direct correlations between gI polymorphisms and specific viral phenotypes are still being elucidated, several methodological approaches can address this question:

  • Genotype-phenotype association studies:

    • Comparing gI sequences from isolates with different clinical manifestations

    • Correlating specific polymorphisms with viral titers or spread rates in vitro

    • Analyzing associations between gI variants and disease severity or recurrence frequency

  • Recombinant virus approaches:

    • Engineering viruses with different natural gI variants

    • Creating chimeric gI molecules to map functional domains

    • Site-directed mutagenesis targeting specific polymorphic residues

  • Structural biology integration:

    • Mapping polymorphic residues onto available structural data

    • Computational modeling of how variants might affect protein-protein interactions

    • Molecular dynamics simulations to predict functional consequences of variations

The polymorphic tandem repeat regions in gI may affect protein structure and function, potentially influencing virus-host interactions, immune evasion capacity, or cell-to-cell spread efficiency . Understanding these structure-function relationships requires integrated approaches combining genetics, structural biology, and functional virology.

How does glycoprotein I interact with glycoprotein E to form a functional complex?

The interaction between glycoprotein I and glycoprotein E to form the functionally important gE-gI complex involves specific domains of both proteins. Methodologically, this interaction can be studied through several complementary approaches:

  • Co-immunoprecipitation and pull-down assays:

    • Using tagged recombinant proteins to isolate and characterize the complex

    • Analyzing the stoichiometry and stability of the interaction

    • Identifying critical residues through mutational analysis

  • Structural biology approaches:

    • X-ray crystallography or cryo-electron microscopy of the complex

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • FRET-based assays to study the interaction in living cells

  • Functional reconstitution:

    • Assessing Fc receptor activity of reconstituted complexes

    • Measuring binding affinities using surface plasmon resonance

    • Testing how mutations affect complex formation and function

The gE-gI complex functions as an Fc receptor, binding the Fc portion of host IgG antibodies. This activity contributes to immune evasion by potentially preventing antibody-mediated neutralization and complement activation, similar to how glycoprotein C has been shown to shield glycoprotein D from neutralizing antibodies .

What roles does the glycoprotein I-E complex play in immune evasion?

The gE-gI complex contributes to HSV-1 immune evasion through several mechanisms that can be studied using specialized experimental approaches:

  • Fc receptor activity:

    • Binding assays with different IgG subclasses and species

    • Competition experiments with soluble Fc fragments

    • Antibody bipolar bridging models where antibody simultaneously binds viral antigens and the gE-gI complex

  • Protection from antibody neutralization:

    • Comparative neutralization assays with wild-type and gI/gE-null viruses

    • Analysis of antibody and complement deposition on virions

    • Assessment of antibody-dependent cellular cytotoxicity against infected cells

  • Shielding of antigenic epitopes:
    Similar to how glycoprotein C shields glycoprotein D from neutralizing antibodies , the gE-gI complex may physically protect other viral glycoproteins from antibody recognition. This can be studied through:

    • Accessibility assays using antibodies against various glycoproteins

    • Electron microscopy visualization of antibody binding patterns

    • Cross-linking studies to map spatial relationships between envelope components

Understanding these immune evasion mechanisms has important implications for vaccine development and antiviral strategies targeting the HSV-1 envelope.

How can interaction partners of glycoprotein I be systematically identified and validated?

Systematic identification and validation of gI interaction partners require multi-faceted approaches:

Discovery Methods:

  • Proximity-dependent biotin labeling (BioID or TurboID) with gI as the bait

  • Affinity purification-mass spectrometry (AP-MS) using tagged gI

  • Yeast two-hybrid screening with different gI domains

  • Protein microarray screening against cellular protein libraries

Validation Approaches:

  • Co-immunoprecipitation from infected cells

  • Bimolecular fluorescence complementation (BiFC) in living cells

  • FRET or BRET assays to confirm proximity in cellular context

  • Surface plasmon resonance to determine binding kinetics

Functional Characterization:

  • siRNA knockdown of identified partners to assess impact on viral replication

  • CRISPR-Cas9 knockout cell lines to confirm partner relevance

  • Competitive inhibition using peptides derived from interaction interfaces

  • Specific mutations in gI to disrupt individual interactions

This systematic approach can reveal both viral and cellular proteins that interact with gI, expanding our understanding of its roles beyond the well-characterized gE interaction.

How can recombinant glycoprotein I be utilized for developing HSV-1 vaccines?

Recombinant gI holds potential for HSV-1 vaccine development through several strategic approaches:

Subunit Vaccine Strategies:

  • Identification of conserved, immunogenic epitopes across clinical isolates

  • Creation of multivalent formulations combining gI with other glycoproteins (gD, gB)

  • Design of chimeric proteins incorporating protective epitopes from multiple glycoproteins

  • Development of nanoparticle-based presentations to enhance immunogenicity

Genetic Diversity Considerations:
Vaccine design must address the genetic diversity observed in gI across clinical isolates . This requires:

  • Analysis of polymorphic regions and their impact on epitope presentation

  • Selection of conserved domains as vaccine targets

  • Potential inclusion of multiple variant sequences to provide broader coverage

  • Evaluation of geographic strain variations that might affect vaccine efficacy

Immunological Assessment:

  • Determination of neutralizing vs. non-neutralizing antibody responses

  • Evaluation of T-cell epitopes through prediction and experimental validation

  • Challenge studies comparing vaccines based on different gI variants

  • Assessment of protection against diverse clinical isolates

While current HSV vaccine candidates have primarily focused on glycoproteins directly involved in entry (gD, gB), including gI in vaccine formulations may enhance protection by targeting the virus's immune evasion mechanisms.

What approaches allow effective study of glycoprotein I's role in neuronal infection and latency?

Studying gI's role in neuronal infection and HSV-1 latency requires specialized techniques:

Ex Vivo Neuronal Models:

  • Microfluidic chamber systems to separate neuronal soma from axons

  • Primary sensory neuron cultures from dorsal root or trigeminal ganglia

  • Human iPSC-derived sensory neurons for species-relevant studies

  • Compartmentalized culture systems to study anterograde and retrograde transport

Recombinant Virus Tools:

  • Creation of fluorescently-tagged gI to visualize trafficking during infection

  • Development of gI-null mutants and complemented viruses for functional studies

  • Construction of inducible expression systems to control gI presence during latency

  • Engineering of chimeric viruses with gI domains from different HSV strains

Analytical Methods:

  • Live-cell imaging of fluorescent viruses in neuronal cultures

  • ChIP-seq to identify gI interactions with host chromatin during latency

  • Single-cell transcriptomics to assess cell-specific responses to gI variants

  • Fluorescence in situ hybridization to visualize viral genome location

These approaches can reveal whether gI contributes to the establishment, maintenance, or reactivation from latency in sensory neurons—processes fundamental to HSV's pathogenic cycle.

How can modifications to glycoprotein I be used to develop targeted HSV-1 vectors?

Engineered modifications to gI can create HSV-1 vectors with altered tropism or tracking capabilities:

Vector Engineering Strategies:

  • Domain swapping between gI and targeting ligands to redirect viral binding

  • Incorporation of imaging reporters (fluorescent proteins, luciferase) as gI fusions

  • Addition of cell-specific targeting moieties to create vectors with enhanced neuronal specificity

  • Development of conditionally functional gI variants responsive to specific cellular environments

The methodology for creating such vectors follows similar principles to those documented for other glycoproteins :

  • Design of modified gI constructs with preserved structural integrity

  • Generation of recombinant viruses through homologous recombination

  • Selection and purification through multiple rounds of plaque purification

  • Verification through sequencing and functional characterization

Applications of Modified gI Vectors:

  • Neural circuit tracing with enhanced specificity for particular neuron types

  • Targeted oncolytic virotherapy with cancer cell-specific entry mechanisms

  • Improved gene therapy vectors with reduced off-target effects

  • Traceable vectors for in vivo imaging of viral infection progression

Creating such vectors requires careful consideration of gI's structural domains and functional interactions to ensure that modifications achieve the desired targeting while maintaining viral viability.

What are common technical challenges when working with recombinant glycoprotein I and how can they be addressed?

Researchers working with recombinant gI frequently encounter specific technical challenges that require methodological solutions:

ChallengePotential SolutionsValidation Methods
Poor expression yields- Optimize codon usage for expression system
- Test different signal peptides
- Express discrete domains rather than full-length protein
- Use fusion partners to enhance solubility
- SDS-PAGE quantification
- Western blot comparison
- qPCR for transcript levels
Improper glycosylation- Select appropriate eukaryotic expression system
- Engineer glycosylation sites if needed
- Consider using glycosylation inhibitors for structure studies
- Mass spectrometry glycan analysis
- Lectin blotting
- Glycosidase sensitivity testing
Protein aggregation- Screen buffer conditions systematically
- Add stabilizing agents (glycerol, arginine)
- Express at lower temperatures
- Use detergents for membrane-spanning constructs
- Size exclusion chromatography
- Dynamic light scattering
- Negative-stain electron microscopy
Loss of functional activity- Verify correct disulfide bond formation
- Co-express with binding partners (e.g., gE)
- Avoid freeze-thaw cycles
- Use mild purification conditions
- Functional binding assays
- Circular dichroism to confirm structure
- Thermal shift assays

Additionally, when working with recombinant HSV-1 viruses expressing modified gI, researchers should implement appropriate biosafety measures and develop specialized protocols for virus production and purification to maintain consistent titers and purity.

How should researchers design experiments to distinguish gI-specific functions from those of other glycoproteins?

Distinguishing gI-specific functions requires careful experimental design:

Genetic Approaches:

  • Creation of isogenic virus panel: wild-type, gI-null, gI-rescue, and gI-mutant variants

  • Generation of double mutants (e.g., gI/gE-null) to identify cooperative functions

  • Complementation assays with various gI truncations or domain mutants

  • Comparison with other glycoprotein mutants to establish functional specificity

Biochemical Strategies:

  • In vitro binding assays with purified components to establish direct interactions

  • Competition experiments using soluble gI domains to interrupt specific functions

  • Antibody blocking studies with epitope-mapped antibodies against different glycoproteins

  • Cross-linking studies to capture transient interactions during function

Cellular and Imaging Methods:

  • Live-cell imaging with differentially labeled glycoproteins to track co-localization

  • Super-resolution microscopy to visualize nanoscale organization of glycoproteins

  • FRET/FLIM studies to detect molecular proximity during functional processes

  • Single-particle tracking to monitor dynamics of individual glycoproteins

These complementary approaches allow researchers to confidently attribute observed phenotypes to gI-specific functions rather than secondary effects or functions of other glycoproteins .

What criteria should be used when evaluating contradictory findings about glycoprotein I functions in literature?

When faced with contradictory findings about gI functions, researchers should systematically evaluate literature using these criteria:

  • Methodological differences:

    • Expression systems used (bacterial vs. mammalian)

    • Protein constructs (full-length vs. truncated/domains)

    • Assay conditions and readouts

    • Viral strains employed (laboratory vs. clinical isolates)

  • Technical quality assessment:

    • Appropriate controls included (positive, negative, isogenic comparisons)

    • Sample sizes and statistical analyses

    • Reproducibility across different experimental systems

    • Validation using complementary techniques

  • Context-dependent factors:

    • Cell types used (relevance to natural infection)

    • Presence of other viral proteins or complexes

    • Infection stage examined (attachment, entry, spread, etc.)

    • Host factors that might influence function

  • Resolution strategies:

    • Direct comparison experiments under standardized conditions

    • Collaborative studies between groups reporting discrepancies

    • Meta-analysis of published data with attention to methodological variables

    • Development of consensus assays with defined standards

The presence of polymorphic regions in gI and evidence of recombination in clinical isolates suggest that some contradictory findings might reflect genuine biological diversity rather than experimental artifacts. Researchers should consider whether differences observed between studies might be due to strain-specific variations in gI sequence and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.