Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we will prioritize your specified tag type if provided.
Synonyms
UL45; Envelope protein UL45; 18 kDa protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Human herpesvirus 1 (strain MP) (HHV-1) (Human herpes simplex virus 1)
Target Names
UL45
Target Protein Sequence
MPLRASEHAYRPLGPGTPPVRARLPAAAWVGVGTIIGGVVIIAALVLVPSRASWALSPCD SGWHEFNLGCISWDPTPMEHEQAVGGCSAPATLIPRAAAKQLAAVARVQSARSSGYWWVS GDGIRARLRLVDGVGGIDQFCEEPALRICYYPRSPGGFVQFVTSTRNALGLP
Uniprot No.

Target Background

Function
A crucial virulence factor in HSV neurotropism; it appears essential for glycoprotein B-induced fusion, but dispensable for in vitro growth.
Protein Families
Herpesviridae HHV-1 UL45 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is the UL45 protein in Herpes Simplex Virus Type 1?

The UL45 protein is a gene product of Herpes Simplex Virus Type 1 (HSV-1) that functions as a membrane-associated protein. It is encoded by the UL45 gene and has been identified as a mediator of fusion events during HSV-1 infection. Though classified as nonessential for viral replication in cell culture, UL45 plays a critical role in cell-cell fusion processes, particularly in the context of syncytial (syn) mutations in glycoprotein B (gB). The protein has a molecular size corresponding to 172 amino acids in its wild-type form and contributes to the virulence properties of HSV-1 strains .

How does UL45 contribute to viral pathogenesis?

UL45 contributes to viral pathogenesis primarily through its role in membrane fusion events. Research indicates that UL45 functions as an important mediator of cell-cell fusion during HSV-1 infection, particularly when working in conjunction with glycoprotein B (gB) syncytial mutants. The protein facilitates the formation of giant polykaryocytes (multinucleated cells), which can enhance viral spread between cells without exposure to neutralizing antibodies. This mechanism potentially allows for more efficient viral propagation within infected tissues. Experimental evidence suggests that when UL45 expression is compromised, the cell fusion properties of gB syn mutants are significantly reduced, indicating that UL45 is required for this aspect of viral pathogenesis .

What experimental systems are typically used to study UL45 function?

Researchers studying UL45 typically employ several experimental systems to understand its function. Cell culture systems using permissive cell lines (such as Vero cells) infected with wild-type HSV-1 or various mutant strains are commonly utilized. Syncytial (syn) mutants of HSV-1, which cause extensive cell-cell fusion resulting in giant polykaryocyte formation, serve as particularly valuable tools for studying UL45 function. Molecular techniques including PCR amplification of the UL45 gene, site-directed mutagenesis, cotransfection experiments, and recombinant virus construction are standard approaches. Additionally, Northern blot analysis for RNA transcription assessment and Western immunoblotting for protein expression detection provide crucial insights into UL45 expression levels and patterns .

How can researchers generate UL45 mutants to study its function?

Researchers can generate UL45 mutants through several methodologies. Based on established protocols, one effective approach involves site-directed mutagenesis of cloned UL45 gene fragments. This can be accomplished using PCR-based techniques with primers containing the desired mutation. For example, to create a truncated UL45 protein similar to the A4B mutant described in the literature, researchers would introduce a frameshift mutation, such as a deletion at nucleotide position 230, resulting in premature termination of the protein at 92 amino acids instead of the full 172 amino acids .

Another approach is cotransfection methodology, where cells are simultaneously transfected with viral DNA and a DNA fragment containing the mutated UL45 gene. Homologous recombination will incorporate the mutant gene into the viral genome. These recombinant viruses can then be isolated through plaque purification and characterized by DNA sequencing to confirm the presence of the intended mutation. Northern blot analysis and Western immunoblotting should be performed to verify transcription and translation patterns of the mutated gene .

What experimental design principles should be followed when studying UL45 protein function?

When designing experiments to study UL45 protein function, researchers should adhere to the following principles:

  • Clear variable definition: Establish independent variables (e.g., UL45 expression levels, specific mutations) and dependent variables (e.g., cell fusion activity, viral replication efficiency) with precise measurement methods .

  • Appropriate controls: Include both positive controls (wild-type UL45 expression) and negative controls (UL45-null or truncated variants) in all experiments .

  • Experimental treatment design: Create a series of UL45 variants with systematic mutations to target specific domains or functional regions of the protein .

  • Subject assignment: When using cell culture models, ensure consistent cell passage numbers and culture conditions across experimental groups to minimize variability .

  • Measurement precision: Develop quantitative assays for cell fusion (e.g., counting nuclei per syncytium, luciferase reporter assays for membrane fusion) rather than relying solely on qualitative observations .

  • Replication: Perform at least three independent biological replicates to ensure statistical validity of findings .

  • Sequential approach: Begin with in vitro studies before proceeding to more complex cell culture systems and potentially animal models .

What is the optimal methodology for expressing recombinant UL45 protein?

The optimal methodology for expressing recombinant UL45 protein depends on the specific research questions and downstream applications. Based on research practices with similar viral membrane proteins, the following approach is recommended:

For bacterial expression systems:

  • Clone the UL45 gene into a vector containing a strong inducible promoter (e.g., pET system with T7 promoter)

  • Express in E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Include affinity tags (His6 or GST) for purification, preferably with a cleavable linker

  • Express at lower temperatures (16-25°C) to enhance proper folding

  • Include membrane-solubilizing agents during purification

For mammalian expression systems, which may better preserve native conformation and post-translational modifications:

  • Clone UL45 into vectors with CMV or EF1α promoters

  • Transfect into HEK293T or CHO cells for high expression

  • Consider stable cell line generation for consistent protein production

  • Verify expression using Western blot with anti-UL45 antibodies

  • Extract using mild detergents that preserve membrane protein structure

The choice between these systems should be guided by whether functional activity or high yield is prioritized. For structural studies, mammalian systems may be preferred despite lower yields .

How does UL45 interact with glycoprotein B (gB) during membrane fusion events?

The interaction between UL45 and glycoprotein B (gB) during membrane fusion events involves complex molecular mechanisms that researchers are still elucidating. Based on experimental evidence, UL45 appears to function as a cofactor or modulator of gB-mediated fusion rather than directly initiating fusion itself. The relationship between these proteins is particularly evident in studies of syncytial (syn) mutants of gB, which cause extensive cell-cell fusion resulting in polykaryocyte formation. When UL45 expression is absent or significantly reduced (as seen in mutants like A4B and A61B), the fusogenic activity of gB syn mutants is markedly diminished or completely abolished .

This suggests that UL45 may alter the conformation of gB or influence its interaction with other components of the fusion machinery. Research indicates that UL45 is likely membrane-associated, positioning it appropriately to interact with the transmembrane or cytoplasmic domains of gB. To further investigate this interaction, researchers should consider implementing techniques such as co-immunoprecipitation assays, proximity ligation assays, or fluorescence resonance energy transfer (FRET) to detect direct physical interactions between UL45 and gB in the context of fusion events .

What is the structural basis for UL45's role in membrane fusion?

The structural basis for UL45's role in membrane fusion remains incompletely characterized, presenting an important frontier for researchers in this field. Based on sequence analysis and experimental data, UL45 is predicted to be a type II membrane protein with a single transmembrane domain. The critical functional regions of UL45 likely include both its transmembrane domain and specific extracellular portions that may interact with fusion machinery components.

Experimental evidence from the A4B mutant provides valuable insight into structure-function relationships. This mutant contains a deletion at nucleotide 230, causing a frameshift that results in premature termination at 92 amino acids (compared to the full-length 172 amino acids). This truncation completely abolishes fusion activity, suggesting that the C-terminal portion of UL45 (amino acids 93-172) contains elements essential for its function in membrane fusion .

To fully elucidate UL45's structural basis for fusion, researchers should pursue:

  • High-resolution structural determination through X-ray crystallography or cryo-EM

  • Systematic mutagenesis of specific domains followed by fusion assays

  • Protein interaction studies with other viral glycoproteins involved in the fusion process

  • Molecular dynamics simulations to predict conformational changes during fusion events

How does UL45 expression influence viral tropism and pathogenesis in different tissue types?

The influence of UL45 expression on viral tropism and pathogenesis across different tissue types represents a sophisticated research question that integrates molecular virology with pathophysiology. While UL45 has been characterized as "nonessential" for viral replication in standard cell culture systems, its requirement for efficient cell-cell fusion suggests tissue-specific roles in pathogenesis that warrant investigation .

In tissues where cell-cell spread is particularly advantageous (such as epithelial barriers or neuronal networks), UL45 expression likely enhances viral dissemination by facilitating direct cell-to-cell transmission while evading neutralizing antibodies. This mechanism may be especially relevant in immune-privileged sites or tissues with limited extracellular space.

To investigate this hypothesis, researchers should design experimental approaches that:

  • Compare wild-type and UL45-deficient viral spread in 3D tissue culture models of different human tissues

  • Analyze UL45 expression levels during infection of different cell types using quantitative proteomics

  • Assess the correlation between UL45 expression and clinical outcomes in patient samples

  • Develop animal models with tissue-specific UL45 expression to observe differential pathogenesis

The fusion-promoting activity of UL45 may have evolved as a mechanism to enhance viral fitness in specific anatomical niches, potentially explaining why the protein is conserved despite being "nonessential" in standard laboratory conditions .

What molecular techniques are most effective for detecting UL45 expression?

For effective detection of UL45 expression, researchers should employ complementary techniques that assess both transcription and translation. Based on experimental evidence from studies of HSV-1 UL45, the following methods are recommended:

For RNA detection:
Northern blot analysis has proven effective for detecting UL45 transcripts in infected cells. This technique allows visualization of the approximately 0.7-kb UL45 transcript and can distinguish between wild-type and mutant expression patterns. RT-qPCR provides a more sensitive alternative for quantifying UL45 mRNA levels, particularly when expression is low .

For protein detection:
Western immunoblotting using specific anti-UL45 antibodies remains the gold standard for protein detection. This technique successfully discriminated between cells infected with wild-type virus (showing the expected 18-kDa UL45 protein) versus mutants like A4B and A61B (showing no detectable UL45 protein) or 1ACSS (showing reduced UL45 expression) .

For localization studies:
Immunofluorescence microscopy using anti-UL45 antibodies can reveal the subcellular distribution of UL45, which is particularly relevant for understanding its membrane-associated functions.

The comparative effectiveness of these techniques is summarized in the following table:

TechniqueSensitivitySpecificityInformation ProvidedLimitations
Northern blotModerateHighTranscript size, abundanceRequires substantial RNA
RT-qPCRVery highHighPrecise quantificationNo size information
Western blotHighHighProtein size, abundanceAntibody quality dependent
ImmunofluorescenceModerateModerate-HighSubcellular localizationMay detect non-specific signal

For comprehensive analysis, combining RT-qPCR for sensitive quantification with Western blotting for protein verification provides the most robust approach to UL45 expression detection .

How can researchers differentiate between direct and indirect effects of UL45 on membrane fusion?

Differentiating between direct and indirect effects of UL45 on membrane fusion requires sophisticated experimental approaches that isolate specific molecular interactions. Researchers should implement the following strategies:

  • Conditional expression systems: Develop cell lines with inducible UL45 expression to observe immediate versus delayed effects on fusion after expression initiation. Direct effects would manifest rapidly after UL45 induction, while indirect effects through signaling cascades or protein expression changes would show temporal delay.

  • Domain-specific mutagenesis: Create a systematic panel of UL45 mutants with alterations in specific functional domains. By correlating structural changes with fusion phenotypes, researchers can identify regions directly involved in the fusion process versus those that might affect cellular pathways indirectly.

  • Protein-protein interaction studies: Implement techniques such as:

    • Crosslinking followed by mass spectrometry

    • Co-immunoprecipitation with gB and other fusion machinery components

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in living cells

  • Lipid mixing versus content mixing assays: Distinguish between UL45's effects on different stages of membrane fusion using specialized assays:

Fusion StageAssay TypeWhat It MeasuresRelevance to UL45
HemifusionLipid mixingMembrane lipid exchangeDetermines if UL45 affects initial membrane contact
Pore formationContent mixingCytoplasmic exchangeAssesses UL45's role in fusion pore creation
Pore expansionElectrophysiologyIon channel propertiesEvaluates UL45's involvement in pore enlargement
  • Purified component systems: Reconstitute fusion systems using purified components (liposomes with embedded proteins) to test if UL45 alone is sufficient to enhance gB-mediated fusion or requires additional cellular factors .

What statistical approaches are most appropriate for analyzing UL45 functional assays?

When analyzing UL45 functional assays, researchers should select statistical approaches that appropriately address the specific experimental design and data characteristics. Based on standard practices in virology research, the following statistical approaches are recommended:

  • For syncytia formation assays:

    • Count nuclei per syncytium across multiple random fields (n≥20)

    • Apply Poisson regression or negative binomial models to account for count data distribution

    • Use mixed-effects models when analyzing time-course experiments to account for repeated measurements

  • For viral replication comparisons between wild-type and UL45 mutants:

    • Log-transform viral titers to achieve normality

    • Apply ANOVA followed by post-hoc tests (Tukey's HSD) for multiple comparisons

    • Consider non-parametric alternatives (Kruskal-Wallis) if normality cannot be achieved

  • For protein expression quantification:

    • Normalize band intensities to housekeeping proteins

    • Use paired t-tests when comparing expression across conditions within the same experiment

    • Apply Benjamini-Hochberg correction for multiple comparisons in large-scale analyses

  • Power analysis considerations:

    • Based on previous UL45 studies, an effect size of 1.5-2.0 is typical for fusion phenotypes

    • Aim for statistical power of 0.8 or higher

    • Sample size calculations should account for the high variability inherent in viral systems

  • Data visualization:

    • Present individual data points alongside means and error bars

    • Use box plots to display distribution characteristics

    • Consider heat maps for visualizing multiple conditions simultaneously

When reporting results, clearly state the statistical tests used, exact p-values (rather than thresholds), and measures of variability (standard deviation or standard error of the mean as appropriate) .

How might understanding UL45 function contribute to antiviral strategies against HSV-1?

Understanding UL45 function could significantly contribute to novel antiviral strategies against HSV-1 by targeting membrane fusion processes essential for viral spread. Although UL45 is considered "nonessential" for viral replication in standard cell culture, its critical role in cell-cell fusion suggests that targeting this protein could inhibit viral spread through direct cell-to-cell routes, which may be particularly important in tissues and during phases of infection where cell-free virus is effectively neutralized by host antibodies .

Potential antiviral approaches leveraging UL45 research include:

The pursuit of these strategies requires further structural and functional characterization of UL45, particularly identifying its precise molecular interactions during the fusion process.

What experimental models best replicate natural HSV-1 infection for studying UL45 function?

For studying UL45 function in contexts that closely replicate natural HSV-1 infection, researchers should consider a hierarchy of experimental models with increasing biological relevance:

  • 3D organotypic tissue cultures: These models represent a significant advancement over traditional monolayer cultures by recapitulating tissue architecture and cell-cell interactions.

    • Human skin equivalents (composed of stratified keratinocytes on a dermal equivalent)

    • Corneal tissue models (particularly relevant for ocular HSV)

    • Neuronal-glial co-cultures or brain organoids (for studying neurotropic aspects)

  • Ex vivo tissue explants: Maintaining actual tissue samples in culture provides excellent physiological relevance.

    • Human or animal skin explants

    • Trigeminal ganglia explants (for latency studies)

    • Corneal tissue (for ocular herpes models)

  • Animal models with specific advantages:

    • Mouse models: Genetically tractable but with differences in receptor usage

    • Guinea pig models: Better recapitulation of human disease and reactivation patterns

    • Rabbit ocular models: Excellent for studying corneal infection and recurrent disease

The optimal experimental design would employ complementary approaches across this spectrum:

Model TypeAdvantagesLimitationsBest Used For
3D tissue culturesControlled conditions, human cells, moderate throughputLack systemic responsesMolecular mechanisms, initial infection events
Tissue explantsAuthentic tissue architecture, primary cellsShort lifespan, variabilityCell-cell spread dynamics, tissue tropism
Mouse modelsGenetic manipulation, whole organismReceptor differencesIn vivo pathogenesis, immune responses
Guinea pig/RabbitClose to human disease patternFewer genetic toolsReactivation studies, vaccine testing

When studying UL45 specifically, these models should be combined with viral constructs expressing fluorescently tagged UL45 or reporter systems that quantify fusion events to maximize the information gained about UL45 function in physiologically relevant contexts .

How does UL45 compare functionally with homologous proteins in other herpesviruses?

UL45 homologs exist across various herpesviruses, presenting an opportunity for comparative functional analysis that can reveal both conserved mechanisms and virus-specific adaptations. The functional comparison of these proteins provides evolutionary insights and may identify broadly applicable antiviral targets.

Based on research findings, the following comparative analysis can be constructed:

HerpesvirusUL45 HomologSizeKnown FunctionsDifferences from HSV-1 UL45
HSV-1 (HHV-1)UL45172 aaMediates cell fusion with gB syn mutants; membrane-associated proteinReference protein
HSV-2 (HHV-2)UL45~175 aaSimilar fusion-enhancement roles; virion componentHigher conservation with HSV-1 UL45 (>85% similarity)
VZV (HHV-3)ORF49~180 aaLess characterized; potential role in cell-cell spreadMore divergent sequence, conserved membrane topology
HCMV (HHV-5)UL45~900 aaRibonucleotide reductase homolog; different functionDramatically different size and function despite name
EBV (HHV-4)BORF2~300 aaFunctions in host immune evasionLimited functional similarity

Key comparative findings:

  • The most conserved UL45 functions appear within alphaherpesviruses (HSV-1, HSV-2, VZV), suggesting that the fusion-enhancing role evolved early in this lineage.

  • Despite nomenclature similarities, betaherpesvirus "UL45" proteins (like HCMV UL45) are functionally distinct and demonstrate how functional divergence can occur even with maintained gene positioning.

  • The conservation of membrane association across herpesvirus UL45 homologs suggests this localization is critical for function, even when specific activities have diverged.

For researchers, these comparisons highlight the importance of considering both sequence homology and functional analysis when studying UL45 across different herpesvirus systems. Cross-complementation experiments (e.g., expressing HSV-2 UL45 in HSV-1 UL45-null mutants) can further delineate which functional aspects are conserved and which are virus-specific .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.