Recombinant Human herpesvirus 1 Envelope glycoprotein K (gK)

Shipped with Ice Packs
In Stock

Description

Functional Roles in HSV-1 Pathogenesis

gK is integral to viral replication and immune evasion:

  • Membrane Fusion Modulation: Interacts with glycoprotein B (gB) to regulate cell-cell fusion and virion entry .

  • Virion Envelopment: Collaborates with UL20 to facilitate cytoplasmic virion envelopment, a step critical for viral egress .

  • Immune Exacerbation: Overexpression of gK in recombinant HSV-1 strains (e.g., HSV-gK3) intensifies corneal scarring (CS) and chronic infection in mice by recruiting CD8+ T-cells .

Enhanced Pathogenicity of Recombinant gK-Expressing HSV-1

  • HSV-gK3 Virus: A recombinant HSV-1 strain expressing two additional gK copies under the LAT promoter showed:

    • Increased CS Severity: BALB/c and C57BL/6 mice exhibited 2–3× higher corneal scarring than wild-type-infected mice .

    • Chronic Infection: Persistent gK and gB transcripts in trigeminal ganglia (TG) of C57BL/6 mice at 30 days post-infection .

    • CD8+ T-Cell Dependence: T-cell depletion reduced CS severity, confirming immunopathological mechanisms .

Therapeutic Targeting of gK Interactions

  • SPP Binding Inhibition: gK binds signal peptide peptidase (SPP) via cytoplasmic domains (residues 31–68). Peptide blockers (e.g., L685,458) reduced HSV-1 infectivity in vitro and in vivo .

  • Akt-1 Pathway Disruption: Deletion of gK residues 31–68 inhibits gB-Akt-1 binding, blocking viral entry .

Applications in Virology Research

Recombinant gK is utilized to:

  • Study viral entry mechanisms and membrane fusion dynamics .

  • Develop peptide-based inhibitors targeting gK-SPP or gK-gB interactions .

  • Model immune-mediated pathologies like HSK (herpes stromal keratitis) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
gK; UL53; Envelope glycoprotein K; Syncytial protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-338
Protein Length
Full Length of Mature Protein
Species
Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)
Target Names
gK
Target Protein Sequence
ASPLHRCIYAVRPTGTNNDTALVWMKMNQTLLFLGAPTHPPNGGWRNHAHISYANLIAGR VVPFQVPPDATNRRIMNVHEAVNCLETLWYTRVRLVVVGWFLYLAFVALHQRRCMFGVVS PAHKMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQNLVQLFETDPVTFLYH RPAIGVIVGCELIVRFVAVGLIVGTAFISRGACAITYPLFLTITTWCFVSTIGLTELYCI LRRGPAPKNADKAAAPGRSKGLSGVCGRCCSIILSGIAMRLCYIAVVAGVVLVALHYEQE IQRRLFDV
Uniprot No.

Target Background

Function
Glycoprotein that likely modulates membrane fusion events during the secondary envelopment of cytoplasmic capsids budding into specific trans-Golgi network (TGN)-derived membranes. It also plays a role, alongside gB, in virus-induced cell-to-cell fusion (syncytia formation). It appears to block fusion of virions with infected-cell membranes.
Protein Families
Alphaherpesvirinae glycoprotein K family
Subcellular Location
Host cell membrane; Multi-pass membrane protein. Host endosome membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of HSV-1 glycoprotein K?

Glycoprotein K (gK) is a highly hydrophobic 338-amino acid protein with a predicted molecular mass of 37 kDa that forms part of the HSV-1 envelope . It contains a cleavable 30-amino-acid NH₂-terminal signal sequence and undergoes N-glycosylation specifically at amino acid positions 48 and 58 . In HSV-1 infected cells, gK is initially expressed as a 39 kDa high-mannose precursor polypeptide (designated pgK), which undergoes further glycosylation to produce a mature 41 kDa glycoprotein .

From a functional perspective, gK serves as a critical determinant for:

  • Viral-induced cell fusion processes

  • Cytoplasmic virion envelopment

  • Virion egress and intercellular spread

  • Corneal infection establishment

  • Neuroinvasion of trigeminal ganglia

How does gK contribute to HSV-1 pathogenesis in ocular models?

Glycoprotein K plays a crucial role in HSV-1 ocular pathogenesis through multiple mechanisms. Studies using recombinant viruses with gK gene deletions (MKΔgK) have demonstrated that gK is essential for efficient replication and spread within the corneal epithelium . When this gene is deleted, the virus shows severely impaired ability to propagate in mouse corneas compared to wild-type or rescued viruses .

More significantly, gK is uniquely implicated in corneal scarring (CS), also known as Herpes Stromal Keratitis (HSK). It remains the only known HSV-1 glycoprotein whose presence exacerbates corneal scarring when used for immunization . This immunopathological response appears to be mediated through stimulation of CD8+ T-cell responses, as demonstrated in T-cell depletion studies with C57BL/6 mice .

Experiments with recombinant viruses expressing additional copies of gK (HSV-gK3) have shown significantly enhanced corneal scarring compared to wild-type McKrae virus infections, firmly establishing a causal relationship between increased gK levels and severity of eye disease .

What role does gK play in HSV-1 neuroinvasion and latency?

Glycoprotein K is critical for HSV-1 neuroinvasion and establishment of latency in the trigeminal ganglia. Research using the MKΔgK deletion mutant virus has revealed that:

  • In scarified mice, 0/20 infected with MKΔgK produced infectious virus after trigeminal ganglia coculture with permissive cells, compared to 19/20 with the rescued MKgK virus .

  • HSV DNA was detected in trigeminal ganglia by PCR in only 3/20 scarified mice inoculated with MKΔgK, versus 19/20 scarified mice inoculated with MKgK .

  • In unscarified mice, the difference was even more striking, with 0/12 MKΔgK-infected mice showing HSV DNA in trigeminal ganglia compared to 9/12 with MKgK .

These findings demonstrate that gK is essential for efficient HSV-1 neuroinvasion and establishment of latency in the trigeminal ganglia. Conversely, research with the HSV-gK3 recombinant virus (expressing additional copies of gK) showed that increased gK levels promote chronic infection, as evidenced by persistent detection of gK transcripts in trigeminal ganglia on day 30 post-infection .

How do recombinant HSV-1 strains with modified gK expression affect viral pathogenesis?

Recombinant HSV-1 strains with modified gK expression demonstrate significant alterations in viral pathogenesis compared to wild-type viruses. Research has characterized several key experimental systems:

Table 1: Comparison of Recombinant HSV-1 Strains with Modified gK Expression

Virus StraingK ModificationKey PhenotypesTrigeminal Ganglia OutcomesReference
MKΔgKComplete gK deletionUnable to spread in mouse corneas; No clinical signsNo infectious virus recovery; HSV DNA detected in only 15% of scarified mice
MKgKRescued wild-typeEfficient corneal spread; Clinical signs presentInfectious virus recovery in 95% of scarified mice; HSV DNA in 95% of scarified mice
HSV-gK3Two additional gK copies (total of 3)Enhanced corneal scarring; Increased pathogenesisgK transcripts detected 30 days post-infection; Free virus detected in C57BL/6 mice at day 30
dLAT2903Parental strain for HSV-gK3Wild-type levels of gKLower corneal scarring than HSV-gK3

The HSV-gK3 recombinant virus, which overexpresses gK, demonstrates that increased levels of this glycoprotein significantly enhance pathogenesis. In both BALB/c and C57BL/6 mouse strains, HSV-gK3 infection resulted in higher corneal scarring compared to wild-type McKrae virus infection . Additionally, C57BL/6 mice infected with HSV-gK3 showed evidence of chronic infection, with free virus detectable in trigeminal ganglia 30 days post-infection .

T-cell depletion studies further revealed that the enhanced corneal scarring observed with HSV-gK3 infection was specifically mediated by CD8+ T-cell responses, indicating an immunopathological mechanism underlying gK-associated disease enhancement .

What protein-protein interactions are critical for gK function in HSV-1 infection?

Research has identified several critical protein-protein interactions that are essential for proper gK function during HSV-1 infection:

  • gK-UL20 Interaction: The HSV-1 UL20 protein is required to interact with gK for successful HSV-1 infection . This interaction appears to be fundamental for proper gK localization and function.

  • UL20-dependent Cell Surface Expression: Studies have demonstrated that UL20 has a critical role in facilitating the cell surface expression of gK, although it is not required for gK-mediated cell fusion .

  • Envelope Formation Complex: Both gK and UL20 form part of a complex essential for virion envelopment. Virions lacking either gK or UL20 fail to form a proper envelope, highlighting their interdependent roles in this critical process .

  • UL37 Interaction: The HSV-1 UL37 protein interacts with the gK-UL20 protein complex in infected cells and facilitates cytoplasmic virion envelopment . This three-way interaction constitutes a functional complex necessary for proper virion formation.

The identification of these interactions provides potential targets for antiviral strategies. Disrupting the gK-UL20 interaction or the association of this complex with UL37 could potentially inhibit viral replication by preventing proper envelope formation and virion egress.

How does single-cell RNA sequencing enhance our understanding of HSV-1 gK in infection dynamics?

Single-cell RNA sequencing (scRNA-seq) technology provides unprecedented insights into the heterogeneity of cellular responses to HSV-1 infection, including the role of gK. This approach allows researchers to:

  • Define precise temporal ordering of viral gene expression, including gK (UL53) expression relative to other viral genes .

  • Identify set-wise emergence patterns of viral genes during infection progression .

  • Detect host cell genes and pathways relevant for infection through multiple computational approaches:

    • Gene and pathway overdispersion analysis

    • Prediction of cell-state transition probabilities

    • Forecasting of future cell states

Using scRNA-seq, researchers have identified specific transcriptional programs that correlate with increased resistance to HSV-1 infection. For example, activation of the transcription factor NRF2 appears to restrict viral infection, suggesting potential therapeutic approaches . This method allows for detailed examination of how gK expression correlates with changes in host cell transcriptomes at various stages of infection.

What techniques are most effective for generating recombinant HSV-1 with modified gK expression?

Several methodologies have proven effective for generating recombinant HSV-1 with modified gK expression:

Insertional/Deletion Mutagenesis with Marker Genes:
This approach was successfully used to create the MKΔgK virus, where the gK gene was deleted and replaced with a gene cassette expressing enhanced green fluorescence protein (EGFP) . The procedure involves:

  • Design of targeting constructs with homologous flanking regions

  • Transfection of constructs into cells infected with wild-type virus

  • Selection of recombinant viruses using fluorescence or drug resistance markers

  • Plaque purification to isolate clonal recombinant viruses

  • Verification of desired genetic modifications through PCR and sequencing

Rescue of Deleted Genes:
The MKgK rescued virus was constructed by reintroducing the wild-type gK gene into the MKΔgK deletion mutant . This approach confirms the phenotypic effects are specifically due to gK deletion rather than unintended mutations elsewhere in the viral genome.

LAT Region Replacement for Additional Gene Copies:
The HSV-gK3 virus was generated by inserting two additional copies of the gK gene in place of the latency-associated transcript (LAT) . This strategy allows for overexpression studies while minimizing disruption of essential viral functions.

These methods can be adapted based on specific research questions. For example, site-directed mutagenesis can be employed to create point mutations in gK to study structure-function relationships, while BAC (bacterial artificial chromosome) mutagenesis systems provide additional options for precise genetic manipulation of the HSV-1 genome.

What animal models are optimal for studying gK functions in HSV-1 ocular infections?

Research on HSV-1 gK has employed several animal models, each with specific advantages:

  • BALB/c Mice:

    • Highly susceptible to HSV-1 infection

    • Develop robust corneal scarring following infection

    • Show consistent neuroinvasion patterns

    • Used extensively in studies comparing MKΔgK and MKgK viruses

    • Also used to study HSV-gK3 overexpression effects

  • C57BL/6 Mice:

    • Different genetic background allows comparison of host factors

    • Show different patterns of chronic infection compared to BALB/c

    • Particularly useful for T-cell depletion studies that identified CD8+ T-cell involvement in gK-mediated corneal scarring

    • C57BL/6 mice infected with HSV-gK3 exhibited free virus in trigeminal ganglia 30 days post-infection, unlike BALB/c mice

  • NZW Rabbits:

    • Larger eye size allows more detailed assessment of corneal pathology

    • Demonstrated enhancement of corneal scarring by the 8-mer (ITAYGLVL) peptide within gK signal sequence

    • Useful for translational studies due to similarity to human eye anatomy

  • Humanized HLA-A Mouse Models:

    • Express human HLA molecules

    • Allow investigation of human-relevant immune responses to gK

    • Valuable for development of human-targeted vaccines or immunotherapies

What are the methodological challenges in detecting and quantifying gK expression in experimental systems?

Detecting and quantifying glycoprotein K poses several methodological challenges due to its biochemical properties and expression patterns:

  • Hydrophobicity and Membrane Integration:

    • gK is highly hydrophobic and integrates into membranes

    • Traditional protein extraction methods may yield poor recovery

    • Specialized detergent-based extraction protocols are required

    • Membrane fraction isolation techniques may improve detection

  • Post-translational Modifications:

    • gK undergoes N-glycosylation at positions 48 and 58

    • Expression appears as multiple species (29-, 35-, 38-, and 40-kDa polypeptides) in baculovirus expression systems

    • Deglycosylation treatments (e.g., tunicamycin) may be necessary to confirm identity

    • In HSV-1 infected cells, gK appears as a 39 kDa precursor (pgK) and a 41 kDa mature form

  • Subcellular Localization Variability:

    • gK localization depends on interaction with UL20

    • Improper folding or trafficking may occur in certain expression systems

    • Immunofluorescence detection requires careful consideration of fixation and permeabilization methods

  • RNA Detection in Latently Infected Tissues:

    • Low abundance of transcripts requires sensitive methods

    • RT-PCR has been successfully used to detect gK transcripts in trigeminal ganglia 30 days post-infection

    • Nested PCR approaches may enhance sensitivity

    • Single-cell RNA sequencing offers higher resolution but requires specialized analysis

  • Quantification Methods:

    • Western blotting with glycoprotein-specific antibodies

    • Quantitative RT-PCR for transcript levels

    • Mass spectrometry for absolute quantification

    • Flow cytometry for cell surface expression

Researchers have addressed these challenges using complementary approaches. For example, studies have confirmed gK expression by comparing wild-type virus with gK deletion mutants , and by detecting gK-related polypeptides of various molecular weights in expression systems .

What therapeutic strategies targeting gK show promise for treating HSV-1 ocular infections?

Given the critical role of glycoprotein K in HSV-1 pathogenesis, several therapeutic strategies targeting this glycoprotein show promise:

Each of these approaches requires rigorous testing in appropriate animal models before advancing to clinical studies. The complex role of gK in both viral replication and immunopathology necessitates careful evaluation of both antiviral efficacy and potential side effects.

How might comparative studies of gK across different herpesviruses inform HSV-1 research?

Comparative studies of glycoprotein K across different herpesviruses can significantly enhance our understanding of HSV-1 gK function and evolution:

  • Functional Conservation Analysis:
    Research has shown that gK from pseudorabies virus and varicella-zoster virus plays roles in virion morphogenesis and egress similar to HSV-1 gK . Comparing functional domains across these viruses can identify critical conserved regions that might represent particularly important therapeutic targets.

  • Cross-Species Interaction Partners:
    The interaction between gK and UL20 appears to be conserved across alphaherpesviruses. For example, studies with Bovine herpesvirus type 1 (BoHV-1) demonstrated that BoHV-1 gK and UL20 proteins function together similarly to their HSV-1 counterparts . Comparative analysis of these interactions can reveal structural requirements and potential vulnerabilities.

  • Evolutionary Analysis of Immunogenic Regions:
    Since HSV-1 gK uniquely exacerbates corneal scarring, comparing immunogenic regions across herpesvirus gK proteins may help identify the molecular basis for this property. The 8-mer peptide (ITAYGLVL) within the gK signal sequence that enhances corneal scarring could be analyzed across species for conservation or variation.

  • Structural Biology Approaches:
    Comparative structural analysis using techniques like cryo-electron microscopy across different herpesvirus gK proteins could reveal common architectural features that underlie function. Such information would be invaluable for structure-based drug design targeting gK.

  • Cross-Species Pathogenesis Models:
    Studying how gK functions differ across species-specific viruses in their natural hosts could provide insights into host-pathogen co-evolution and identify species-specific adaptations versus fundamental functions.

These comparative approaches could accelerate discovery by leveraging evolutionary relationships to identify the most critical aspects of gK function and potentially reveal unexpected therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.