Recombinant Human herpesvirus 1 Virion egress protein UL34 (UL34)

Shipped with Ice Packs
In Stock

Description

Role in Viral Replication

Deletion of UL34 results in:

  • Severe replication defects: Viral titers reduced by 3–5 log orders .

  • Failed envelopment: Capsids accumulate in the nucleus without cytoplasmic virions .

  • Altered UL31 localization: UL31 becomes diffusely nuclear instead of rim-localized .

Table 1: Phenotypic Comparison of Wild-Type vs. UL34-Null HSV-1

ParameterWild-Type HSV-1UL34-Null Mutant
Plaque FormationRobust plaquesMinute plaques (2–10 cells/plaque)
Single-Step GrowthHigh titers (~10⁷ PFU/mL)Reduced titers (~10³–10⁴ PFU/mL)
UL31 LocalizationNuclear rimDiffuse nuclear
Capsid LocalizationCytoplasmic enveloped virionsNuclear capsid accumulation

Research Applications

The recombinant UL34 protein is critical for:

  • In vitro budding assays: Studying NEC-mediated membrane deformation .

  • Complementation studies: Rescuing UL34-null viruses in transfected cells .

  • Structural analysis: Mapping residues critical for UL31 binding (e.g., K137, R139) .

Notable findings:

  • Mutation of UL34’s oligomeric interface residues (e.g., D35A, E37A) disrupts NEC budding efficiency in vitro .

  • Phosphorylation by US3 kinase modulates UL34’s interaction with dynein intermediate chain, affecting capsid transport .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NEC2; UL34; Nuclear egress protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Target Names
NEC2
Target Protein Sequence
MAGLGKPYTGHPGDAFEGLVQRIRLIVPSTLRGGDGEAGPYSPSSLPSRCAFQFHGHDGS DESFPIEYVLRLMNDWAEVPCNPYLRIQNTGVSVLFQGFFHRPHNAPGGAITPERTNVIL GSTETTGLSLGDLDTIKGRLGLDARPMMASMWISCFVRMPRVQLAFRFMGPEDAGRTRRI LCRAAEQAITRRRRTRRSREAYGAEAGLGVAGTGFRARGDGFGPLPLLTQGPSRPWHQAL RGLKHLRIGPPALVLAAGLVLGAAIWWVVGAGARL
Uniprot No.

Target Background

Function

Human herpesvirus 1 virion egress protein UL34 (UL34) plays a critical role in virion nuclear egress, the initial step of virion release from infected cells. Within the host nucleus, UL34 interacts with the newly formed capsid via its vertices, directing it to the inner nuclear membrane through its association with NEC2. UL34 induces capsid budding at the inner nuclear membrane and its subsequent envelopment within the perinuclear space. The UL34/NEC2 complex facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm, where it progresses to secondary budding sites in the Golgi apparatus or trans-Golgi network.

Gene References Into Functions
  1. HSV-1 UL34's role in ER remodeling and efficient targeting of regulatory proteins to the nuclear membrane was identified. (PMID: 28356536)
  2. A pUL34 point mutant (Q163A) exhibiting defects in nuclear architecture alteration, lamin A/C redistribution, single-step growth, plaque formation, and nuclear egress was characterized. (PMID: 27654296)
  3. Post-translational membrane insertion of HSV-1 pUL34 was demonstrated, with a minimum of 15 residues required for stable membrane anchoring. (PMID: 21832006)
  4. A mutation in pUL34's inner nuclear membrane-targeting domain impaired infectious virus production and plaque formation. (PMID: 21900173)
  5. UL34 localization to the nuclear rim of rabbit skin cells infected with a UL31 deletion HSV-1 virus was observed. (PMID: 15476875)
  6. A model proposing pUS3 and PKCδ recruitment by pUL34, leading to emerin hyperphosphorylation, disruption of its lamin protein connections, and nuclear lamina disruption was suggested. (PMID: 17652388)
  7. The roles of lamin A/C, lamin B1, and viral US3 kinase in viral infectivity, virion egress, and targeting of UL34 to the inner nuclear membrane were investigated. (PMID: 18524819)
  8. UL34's significant influence on gM enrichment in the inner nuclear membrane at the expense of the outer nuclear membrane was shown. (PMID: 19279119)
Database Links

KEGG: vg:2703355

Protein Families
Herpesviridae NEC2 protein family
Subcellular Location
Host nucleus inner membrane; Single-pass membrane protein.

Q&A

What is UL34 protein and what is its role in HSV-1 replication?

UL34 is a phosphoprotein encoded by the UL34 gene of herpes simplex virus type 1 (HSV-1) that plays a crucial role in viral maturation and egress. It is conserved across all human herpesviruses, suggesting evolutionary importance . UL34 is primarily localized to the nuclear envelope of infected cells where it participates in the envelopment of nucleocapsids at the inner nuclear membrane . Studies utilizing UL34 deletion mutants demonstrate that this protein is essential for efficient viral replication, as recombinant viruses lacking UL34 replicate to titers 3-5 log orders of magnitude lower than wild-type viruses . Electron microscopic analyses reveal that in the absence of UL34, morphogenesis proceeds normally to the formation of DNA-containing nuclear capsids, but enveloped virus particles are absent in the cytoplasm or at the cell surface, indicating UL34's critical role in the envelopment process .

What is the molecular structure and membrane topology of UL34?

UL34 is predicted to be a type II integral membrane protein with an approximate molecular weight of 30,000 Da . Sequence analysis indicates that UL34 has no cleavable signal sequence but contains a transmembrane domain near its C-terminus . The protein's structure features a long cytoplasmic N-terminal domain and a very short luminal or extracellular C-terminal domain . This membrane topology is consistent with UL34's role in mediating interactions at the nuclear envelope, where it forms part of the viral envelopment machinery . The UL34 protein's sequence is well conserved among alphaherpesviruses, and significant sequence similarity exists between HSV-1 UL34 and human cytomegalovirus (HCMV) UL50 protein, suggesting functional conservation across herpesvirus subfamilies .

How does UL34 interact with other viral proteins during HSV-1 replication?

UL34 functions as part of a nuclear egress complex, primarily interacting with the UL31 protein to facilitate the envelopment of nucleocapsids at the inner nuclear membrane . This UL34-UL31 complex is essential for the primary envelopment process. Additionally, UL34 interacts with the viral US3 protein kinase, which phosphorylates UL34 in HSV-1-infected cells . The functional significance of this phosphorylation appears to be cell type dependent, as demonstrated by studies using UL34 phosphorylation mutants and US3 catalytic-inactive mutants . Gene deletion studies indicate that the HSV-1 envelopment-deenvelopment process involves not only UL34 and UL31 but also UL20, UL11, and US3 proteins, suggesting a complex network of protein interactions during viral egress .

What experimental approaches are most effective for studying UL34 function in viral egress?

The most effective experimental approaches for investigating UL34 function include:

  • Recombinant virus construction: Creating UL34 deletion mutants by replacing the UL34 coding sequence with reporter genes (such as GFP) allows visualization of infected cells and assessment of replication defects .

  • Complementing cell lines: Establishing stably transfected cell lines expressing UL34 (e.g., 143/1099E cells) enables the propagation of UL34-null viruses and facilitates comparison with non-complementing conditions .

  • Single-step growth analyses: Quantitative measurement of virus replication in different cell types provides insights into the cell-type dependence of UL34 function .

  • Electron microscopy: Ultrastructural analysis of infected cells reveals specific morphological defects in viral maturation and egress in the absence of UL34 .

  • Immunofluorescence and immunoelectron microscopy: These techniques allow precise localization of UL34 and assessment of how mutations affect its distribution .

  • Site-directed mutagenesis: Creating phosphorylation site mutants helps determine the functional significance of post-translational modifications to UL34 .

These methodologies, used in combination, have been instrumental in elucidating the critical role of UL34 in HSV-1 replication.

How does the relationship between UL34 and US3 kinase affect viral replication in different cell types?

The functional relationship between UL34 and US3 kinase exhibits distinct cell-type dependence, as revealed by comparative analyses in different cell lines . In HSV-1, UL34 is phosphorylated by the US3 protein kinase, but the significance of this modification varies between cell types .

Studies using phosphorylation site mutants of UL34 and catalytic-inactive US3 mutants have demonstrated that:

Cell TypeEffect of UL34 PhosphorylationEffect of US3 Catalytic ActivityImpact on Viral Replication
HEp-2 cellsImportant for proper UL34 localizationCriticalSignificant reduction in viral titers when phosphorylation is prevented
Vero cellsLess critical for UL34 localizationImportantModest reduction in viral titers when phosphorylation is prevented

These findings suggest that in some cell types, efficient viral replication requires US3-mediated phosphorylation of cellular proteins other than UL34 . The cell-type dependence may reflect differences in cellular factors that interact with the nuclear egress complex or variations in nuclear architecture across cell types. This underscores the complex nature of herpesvirus replication and the importance of studying viral protein functions in multiple cellular contexts .

What is the mechanism by which UL34 facilitates nuclear egress of herpesvirus capsids?

UL34 facilitates nuclear egress through multiple potential mechanisms that likely work in concert:

  • Direct mediation of envelopment: UL34, as an inner nuclear membrane protein, may directly bridge interactions between nucleocapsids and the inner nuclear membrane, facilitating primary envelopment .

  • Recruitment of egress factors: UL34 might direct the localization of other viral and cellular factors essential for nuclear egress to the nuclear envelope .

  • Modification of nuclear lamina: The nuclear lamina presents a physical barrier to nuclear egress, and UL34 may alter this structure to allow nucleocapsids to access the envelopment machinery .

  • Formation of nuclear membrane invaginations: In the absence of US3 (which interacts with UL34), accumulation of enveloped virions in perinuclear space within invaginations of the inner nuclear membrane has been observed, suggesting UL34's role in membrane remodeling .

  • De-envelopment facilitation: UL34, potentially in concert with US3, appears to be involved in the de-envelopment process where perinuclear virions fuse with the outer leaflet of the nuclear membrane to release capsids into the cytoplasm .

Electron microscopic analyses of cells infected with UL34 deletion viruses show normal capsid assembly in the nucleus but a complete absence of enveloped particles in the cytoplasm, confirming UL34's essential role in the nuclear egress pathway .

How do post-translational modifications of UL34 influence its function in different herpesvirus species?

Post-translational modifications, particularly phosphorylation, of UL34 show interesting species-specific patterns among herpesviruses:

HerpesvirusUL34 Phosphorylation StatusKinase ResponsibleFunctional Impact
HSV-1 (Human herpesvirus 1)PhosphorylatedUS3 kinaseCell-type dependent effects on localization and function
PrV (Pseudorabies virus)PhosphorylatedNot by US3 kinaseUS3 affects UL34 localization independent of phosphorylation

In HSV-1, the US3 kinase exclusively phosphorylates UL34, and this modification appears to regulate UL34 function in a cell-type dependent manner . Surprisingly, in pseudorabies virus (PrV), no difference in UL34 phosphorylation was observed in the presence or absence of US3 kinase, suggesting that another cellular or viral kinase is responsible .

Despite this difference, PrV US3 still affects UL34 localization and virus morphogenesis, indicating that US3 may influence UL34 function through mechanisms independent of direct phosphorylation . This species-specific variation highlights the evolutionary adaptability of herpesviruses and suggests that studying UL34 across different herpesvirus species may reveal alternative regulatory mechanisms for this critical egress protein.

What methodological approaches can resolve contradictions in current UL34 research findings?

Several methodological approaches can help resolve existing contradictions in UL34 research:

  • Multi-cell line comparative studies: Given the observed cell-type dependence of UL34 and US3 functions, comprehensive studies across diverse cell types (including primary cells) are essential to reconcile contradictory findings .

  • Mass spectrometry analyses: Detailed mapping of phosphorylation sites and other post-translational modifications on UL34 in different viral species and under various conditions can clarify how these modifications affect function .

  • Live-cell imaging techniques: Real-time visualization of UL34 during infection can provide dynamic information about its role during the viral life cycle, potentially resolving static snapshot contradictions .

  • Cryo-electron tomography: This technique can provide high-resolution structural information about UL34's organization at the nuclear membrane during viral egress .

  • CRISPR-Cas9 genome editing: Creating cellular knockouts of potential interaction partners could help delineate the complex network of UL34 interactions .

  • Cross-species complementation experiments: Testing whether UL34 from one herpesvirus species can complement deletion in another could resolve functional conservation questions .

  • Mathematical modeling: Computational approaches integrating diverse experimental data could help reconcile apparently contradictory observations into a coherent model of UL34 function.

These methodological approaches, when applied systematically, can address current contradictions such as the different relationships between US3 and UL34 across viral species and the varied importance of UL34 phosphorylation in different cell types.

What is the relationship between UL34 expression and viral plaque formation in different cell types?

The relationship between UL34 expression and viral plaque formation varies significantly across cell types, providing important insights into UL34's role in viral spread:

Cell TypePlating Efficiency of UL34-null VirusPlaque MorphologyKey Observations
Complementing 143/1099E cellsSimilar to wild-typeRobust, syncytial plaques containing hundreds of cellsConfirms UL34's role can be complemented in trans
Non-complementing 143B cellsSignificantly reducedMinute plaques with only 2-10 cellsDemonstrates critical role in cell-to-cell spread
HEL299 cellsSimilar to wild-typeSmall plaquesCell-type specific tolerance to UL34 deletion
Vero cellsDramatically reducedVery small plaques when formedHighest dependence on UL34 for plaque formation

These differential effects demonstrate that the requirement for UL34 in plaque formation is cell-type dependent. In all cell types, UL34 deletion results in smaller plaques, but the extent of the defect varies significantly . This suggests that cellular factors may partially compensate for UL34 function in some cell types but not others.

The mechanism underlying these differences remains incompletely understood, but may involve cell-type specific variations in nuclear membrane composition, alternative viral egress pathways, or differences in cell-to-cell contact structures that facilitate viral spread . These observations emphasize the importance of evaluating viral mutants in multiple cell types to fully understand protein function in the viral life cycle.

What are the optimal approaches for generating recombinant UL34 protein for structural and functional studies?

The production of recombinant UL34 protein presents specific challenges due to its transmembrane domain. Based on published methodologies, the following approaches are recommended:

  • Bacterial expression systems:

    • Express the soluble N-terminal domain (excluding the transmembrane region) in E. coli using vectors like pET or pGEX systems

    • Addition of N-terminal tags (His6 or GST) facilitates purification

    • Optimization of induction conditions (temperature, IPTG concentration) is critical for proper folding

  • Mammalian expression systems:

    • Full-length UL34 expression in mammalian cells (e.g., HEK293T) using vectors like pcDNA3.1

    • This approach maintains proper post-translational modifications

    • Stable cell lines expressing UL34 can be generated using antibiotic selection (e.g., G418/Geneticin at 400 μg/ml)

  • Baculovirus expression:

    • For large-scale production of properly modified UL34

    • Particularly valuable for structural studies requiring substantial protein quantities

  • Protein purification considerations:

    • For full-length protein: Detergent solubilization is required (e.g., 1% NP-40 or 0.5% Triton X-100)

    • Purification should be performed at 4°C to prevent degradation

    • Addition of phosphatase inhibitors is essential to maintain native phosphorylation state

When designing constructs, researchers should consider that the functional cytoplasmic N-terminal domain and the transmembrane C-terminal domain may need to be expressed separately depending on the experimental objectives. Verification of proper folding using circular dichroism spectroscopy is recommended before proceeding to functional assays or structural studies.

How can researchers effectively design experiments to elucidate the UL34-US3 regulatory relationship in diverse cellular contexts?

To systematically investigate the complex UL34-US3 regulatory relationship across cellular contexts, researchers should consider the following experimental design strategy:

  • Generation of viral and cellular tools:

    • Create UL34 phosphorylation site mutants (conversion of serine/threonine to alanine or phosphomimetic residues)

    • Develop US3 catalytically inactive mutants (K220A or similar mutations)

    • Establish CRISPR-edited cell lines lacking specific cellular kinases

  • Multi-parameter experimental matrix:

    Experimental VariableParameters to Test
    Cell typesEpithelial (Vero, HEp-2), neuronal, fibroblasts (HEL299), lymphoid
    Viral backgroundsWild-type, US3-null, UL34-null complemented with variants
    Phosphorylation statusNative, phosphatase-treated, hyperphosphorylated
    Cell cycle stageSynchronized populations at different stages
  • Analytical approaches:

    • Quantitative phosphoproteomics to identify all phosphorylation sites on UL34

    • Co-immunoprecipitation assays under varying conditions to detect complex formation

    • Live-cell imaging with fluorescently tagged proteins to monitor localization dynamics

    • Single-step growth curves and plaque size measurements to assess functional outcomes

    • Electron microscopy to evaluate ultrastructural phenotypes

  • Data integration:

    • Multivariate statistical analysis to correlate phosphorylation patterns with phenotypic outcomes

    • Development of predictive models of UL34-US3 interaction across cell types

This comprehensive approach would address currently unresolved issues including: (i) the effect of US3 on UL34 phosphorylation in diverse cell types, (ii) the contribution of other cellular kinases to UL34 modification, and (iii) the specific impact of phosphorylation events on nuclear egress efficiency .

What are the most effective imaging techniques for visualizing UL34 dynamics during herpesvirus infection?

Visualizing UL34 dynamics during herpesvirus infection requires specialized imaging techniques to capture both spatial distribution and temporal changes. The following methodologies offer complementary insights:

  • Super-resolution microscopy approaches:

    • STORM/PALM: Achieve 20-30 nm resolution to precisely locate UL34 within nuclear membrane subdomains

    • SIM (Structured Illumination Microscopy): Provides ~100 nm resolution with faster acquisition for live-cell imaging

    • Advantages: Can resolve UL34 distribution within the narrow (~40 nm) perinuclear space

  • Live-cell imaging techniques:

    • Spinning disk confocal microscopy: Allows rapid acquisition with minimal phototoxicity

    • FRAP (Fluorescence Recovery After Photobleaching): Measures mobility and exchange rates of UL34 in the nuclear membrane

    • Fluorescent protein tags: mNeonGreen or HaloTag provide superior brightness and photostability for long-term imaging

  • Correlative light and electron microscopy (CLEM):

    • Combines fluorescence localization of tagged UL34 with ultrastructural context

    • Critical for connecting molecular dynamics to morphological events during viral egress

    • Implementation: Use GFP-tagged UL34 complemented viruses with subsequent immunogold labeling

  • Sample preparation considerations:

    TechniqueOptimal FixationLabeling StrategySpecial Considerations
    Immunofluorescence4% paraformaldehydeAnti-UL34 antibodiesPermeabilization crucial for nuclear membrane access
    Immunoelectron microscopyGlutaraldehyde/paraformaldehydeGold-conjugated antibodiesLow temperature embedding preserves antigenicity
    Live imagingN/AFluorescent protein fusionVerify fusion protein functionality
  • Quantitative analysis methods:

    • Colocalization analysis with nuclear membrane markers

    • Particle tracking to follow UL34-positive structures

    • Intensity distribution analysis across the nuclear envelope

By combining these approaches, researchers can comprehensively characterize UL34 dynamics, including its recruitment to the nuclear membrane, interaction with nuclear egress complex components, and participation in membrane remodeling during viral infection .

What are the most promising future research directions for understanding UL34's role in herpesvirus pathogenesis?

Future research on UL34 should focus on several key areas that could significantly advance our understanding of herpesvirus egress and potentially identify novel therapeutic targets:

  • Structure-function relationship studies:

    • Determination of UL34 crystal structure, particularly in complex with UL31

    • Mapping of functional domains through systematic mutagenesis

    • Investigation of conformational changes during the envelopment process

  • Host-pathogen interaction network:

    • Comprehensive identification of cellular proteins interacting with UL34

    • Investigation of how UL34 modifies the nuclear lamina

    • Analysis of cell-type specific factors that influence UL34 function

  • Comparative virology approaches:

    • Systematic comparison of UL34 function across alphaherpesviruses, betaherpesviruses, and gammaherpesviruses

    • Evolution of nuclear egress mechanisms and their relationship to host adaptation

  • Therapeutic targeting strategies:

    • Development of small molecule inhibitors targeting the UL34-UL31 interface

    • Peptide-based approaches to disrupt UL34 interactions

    • Evaluation of nuclear egress inhibition as an antiviral strategy

  • Roles in viral pathogenesis:

    • Investigation of UL34 function during in vivo infection using animal models

    • Analysis of UL34's role in establishing latency and reactivation

    • Potential contribution to tissue-specific replication differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.