Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD)

Shipped with Ice Packs
In Stock

Description

Functional Roles in HSV-2 Pathogenesis

HSV-2 gD facilitates viral entry and immune modulation:

Key Functions

  • Receptor Binding: Directly interacts with host receptors nectin-1 and HVEM, initiating viral entry .

  • Membrane Fusion: Recruits glycoproteins gB and gH/gL to enable fusion with host membranes .

  • Immune Evasion: Suppresses early innate immune responses by altering chemokine (CXCL9, CXCL10) and IL-6 production via HVEM interactions .

Vaccine Development

Recombinant gD has been central to HSV-2 vaccine trials:

StudyOutcomeReference
Phase 3 Clinical Trial (gD2 + AS04)73% efficacy against HSV-1, but limited protection against HSV-2
ΔgD-2 Live Attenuated VaccineEnhanced humoral response targeting non-gD antigens (e.g., gB, gC)
Dominant-Negative HSV-2 CJ2-gD2Induced neutralizing antibodies and CD8+ T-cell responses in mice

Diagnostic Tools

  • ELISA/Western Blot: Used to detect HSV-2-specific antibodies in patient sera .

  • Specificity: Reacts with 90–95% of HSV-2-infected individuals, minimal cross-reactivity with HSV-1 .

Immune Response Modulation

  • Chemokine Suppression: Wild-type gD reduces CXCL9/CXCL10 levels by 40–60% compared to HVEM-binding-deficient mutants .

  • Antibody Response: gD is immunodominant, eliciting neutralizing antibodies in >80% of infected individuals .

Challenges and Future Directions

  • Vaccine Limitations: gD-based vaccines show partial efficacy due to immune evasion mechanisms .

  • Diagnostic Gaps: African HSV-2 strains exhibit unique gD/gE/gI signatures, reducing antibody test accuracy .

  • Therapeutic Potential: Dominant-negative HSV-2 strains expressing gD (e.g., CJ2-gD2) may offer dual prophylactic/therapeutic benefits .

Product Specs

Buffer
For liquid formulations, the protein is stored in a Tris/PBS-based buffer containing 5-50% glycerol. Lyophilized powder is prepared using a Tris/PBS-based buffer with 6% Trehalose prior to lyophilization.
Form
Available as Liquid or Lyophilized Powder
Note: We will prioritize shipping the available format. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
3-7 business days
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol uses a final glycerol concentration of 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized powder maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tag
Datasheet & Coa
Please contact us to get it.
Expression Region
26-393aa
Mol. Weight
42.3 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Microbiology
Source
in vitro E.coli expression system
Species
Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Target Names
gD
Target Protein Sequence
KYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function

Herpesvirus 2 envelope glycoprotein D (gD) is a glycoprotein that mediates binding to host cell entry receptors TNFRSF14/HVEM and NECTIN1. It subsequently triggers membrane fusion with the host cell by recruiting the fusion machinery composed of gB and gH/gL.

Gene References Into Functions
  1. CD112 downregulation reduces DNAM-1 binding to both virus-infected and gD-transfected cells. PMID: 25352670
  2. The N-terminus conformation of herpes simplex virus gD is induced by direct binding to HVEM and nectin-1. PMID: 24314649
  3. A herpes simplex virus 2 gD mutant, created via bacterial artificial chromosome mutagenesis, exhibits severely impaired neuronal cell infection, infecting only Vero cells expressing exogenous HVEM. PMID: 22993162
Database Links

KEGG: vg:1487358

Protein Families
Herpesviridae glycoprotein D family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is recombinant HSV-2 envelope glycoprotein D (gD2)?

Recombinant HSV-2 envelope glycoprotein D (gD2) is a protein component of the herpes simplex virus type 2 outer envelope that can be produced through recombinant DNA technology. It typically consists of 393 amino acids when expressed in full-length form and serves as a primary antigen recognized by the immune system during HSV-2 infection . The recombinant form is produced by inserting the human cDNA encoding gD2 into expression vectors like pFastBac HTb, allowing for controlled production of the protein in laboratory settings for research and vaccine development purposes .

Why is gD2 considered a promising vaccine candidate?

Glycoprotein D of HSV-2 is considered a promising vaccine candidate for several compelling reasons. First, clinical studies have demonstrated that recombinant gD2 vaccines can provide partial protection (>70%) against genital herpes disease in HSV-seronegative women . Second, gD2 contains multiple immunodominant epitopes that are effectively recognized by human CD4 T lymphocytes, stimulating robust cellular immune responses . Furthermore, the protein has shown the ability to induce IFN-γ secretion from peripheral blood mononuclear cells when used as an immunogen . These immunological properties, combined with its demonstrated partial prophylactic immune function in guinea pig models of genital herpes, establish gD2 as a significant target for herpes vaccine research .

How does gD2 interact with the host immune system?

The interaction between gD2 and the host immune system primarily involves T cell-mediated responses. Research indicates that CD4 T lymphocytes recognize HSV-2 structural proteins, with gD2 being particularly immunodominant . When presented to the immune system, gD2 stimulates CD4 lymphocytes to secrete interferon-gamma (IFN-γ), a crucial cytokine for antiviral defense mechanisms . Studies have identified multiple immunodominant peptide epitopes within gD2 (typically two to six peptide epitopes recognized by each subject), which exhibit promiscuous binding to multiple DR types in MHC II molecules . This promiscuity in binding enhances the protein's ability to elicit immune responses across genetically diverse populations, making it particularly valuable as a vaccine component.

What are the most effective systems for recombinant gD2 expression?

The baculovirus expression system using Spodoptera frugiperda (Sf9) insect cells has proven highly effective for recombinant gD2 production. This eukaryotic system enables proper post-translational modifications critical for maintaining the biological activity of gD2 . The process typically involves subcloning human cDNA encoding gD2 into appropriate vectors like pFastBac HTb, generating recombinant bacmid DNA, and transfecting Sf9 cells to produce viral stocks for subsequent infection and protein expression . When optimized, this system can yield up to 192 mg/L of recombinant gD2 protein in high-density cell culture, providing sufficient quantities for extensive research applications .

What are the optimal conditions for high-density cell culture for gD2 production?

The production of recombinant gD2 in high-density cell culture requires precise optimization of several key parameters:

ParameterOptimal ConditionFunction
Glucose concentration15 mMPrimary energy source
Glutamine concentration0.4 g/LEssential amino acid for protein synthesis
Dissolved oxygen (DO)40%Ensures proper cell metabolism

Under these optimized conditions, Sf9 cell density can reach 9.6×10^6 cells/mL, maximizing gD2 yield . The cultivation is typically performed in a stirred bioreactor where these parameters can be carefully monitored and controlled. Maintenance of these specific conditions is crucial, as deviations can significantly reduce protein expression levels and potentially impact the biological activity of the recombinant gD2 .

What purification strategies yield the highest purity and activity of recombinant gD2?

Effective purification of recombinant gD2 typically employs a multi-step chromatographic approach. Since the protein is often expressed with a histidine tag when using vectors like pFastBac HTb, immobilized metal affinity chromatography (IMAC) serves as an effective initial purification step . This can be followed by ion exchange chromatography to remove contaminants with different charge properties, and size exclusion chromatography for final polishing and buffer exchange. Throughout the purification process, it's critical to maintain appropriate pH and salt conditions to preserve the protein's conformational integrity and biological activity. The purified recombinant gD2 should be assessed for both purity (through SDS-PAGE and Western blot) and biological activity (through immunological assays) to ensure its suitability for downstream applications such as vaccine formulation or immunological studies .

What are the immunodominant epitopes of gD2 and how are they identified?

The immunodominant epitopes of gD2 are typically identified through a combination of overlapping peptide analysis, cytotoxicity assays, and IFN-γ ELISPOT techniques. Research has revealed that gD2 contains more than six immunodominant epitopes, with each subject typically recognizing between two to six peptide epitopes . The process of epitope mapping often begins with screening a set of overlapping peptides (e.g., 39 overlapping 20-mer peptides spanning the gD2 sequence) using 51Cr-release cytotoxicity and IFN-γ ELISPOT assays . Further fine mapping of immunodominant regions involves testing smaller peptides (e.g., 12-mers) within the reactive 20-mers, combined with MHC II typing and direct in vitro binding assays to individual DR molecules . This approach not only identifies the specific epitopes but also reveals that individual 20-mers and 12-mers can bind promiscuously to multiple DR types, enhancing their immunogenicity across diverse human populations.

What is the role of CD4 T lymphocytes in gD2 recognition?

CD4 T lymphocytes play a crucial role in recognizing gD2 and orchestrating the immune response against HSV-2. Unlike CD8 T lymphocytes, which primarily recognize immediate early/early proteins of HSV, CD4 T lymphocytes predominantly recognize late HSV structural proteins, with gD2 being particularly immunodominant . These CD4 T cells exhibit cytotoxic activity and secrete IFN-γ upon recognition of gD2, contributing to both direct and indirect antiviral mechanisms . CD4 cytotoxic T lymphocytes (CTLs) have been isolated from genital lesions and shown to have anti-HSV activity, suggesting they act early in controlling HSV infection, complemented by CD8 CTLs which act later in the infection process . The recognition of gD2 by CD4 helper cells is fundamental to developing effective vaccine strategies, as these cells provide essential help for antibody production and sustaining CD8 T cell responses .

How should animal models be designed to evaluate gD2-based vaccine efficacy?

Designing animal models for evaluating gD2-based vaccine efficacy requires careful consideration of several factors. Guinea pig models have proven particularly valuable as they develop genital herpes symptoms similar to humans when infected with HSV-2 . A well-designed study should include:

  • Appropriate control groups (unvaccinated, adjuvant-only, and possibly alternative vaccine formulations)

  • Adequate sample sizes determined by power analysis

  • Clear immunization schedules with defined dosages and routes of administration

  • Comprehensive immune response monitoring (antibody titers, T-cell responses, cytokine profiles)

  • Standardized challenge protocols with well-characterized HSV-2 strains

  • Objective clinical scoring systems for assessing disease severity

  • Virus shedding quantification through PCR analysis

The prophylactic immune function of purified recombinant gD2 should be assessed by comparing disease progression, viral shedding, and immunological parameters between vaccinated and control groups . Additionally, researchers should evaluate both primary infection outcomes and recurrence rates, as controlling recurrent episodes represents a significant clinical challenge in HSV-2 infections.

How can researchers analyze contradictory data in gD2 vaccine studies?

When analyzing contradictory data in gD2 vaccine studies, researchers should employ a systematic approach:

  • Examine methodological differences between studies (expression systems, purification methods, adjuvants, dosing, and animal models)

  • Evaluate population differences in human studies (HSV-1 serostatus, gender, age, genetic background)

  • Compare immunological readouts across studies using standardized assays

  • Consider differences in challenge virus strains and protocols

  • Analyze statistical approaches and ensure appropriate power calculations

A contradiction occurs when a proposition conflicts either with itself or established fact and can be used to detect disingenuous beliefs and bias . In the context of gD2 research, apparent contradictions may arise from subtle methodological differences rather than true biological contradictions. For example, the observation that gD2 vaccines protect HSV-seronegative women but not HSV-1 seropositive individuals requires careful analysis of the underlying immunological mechanisms rather than dismissing either finding . By systematically addressing these factors and applying the scientific method to resolve inconsistencies, researchers can advance understanding and refine approaches to gD2-based vaccine development.

What immunological assays are most informative for evaluating gD2 vaccine responses?

The most informative immunological assays for evaluating gD2 vaccine responses include:

  • ELISPOT assays: These measure IFN-γ secretion by T cells in response to gD2 stimulation, providing quantitative data on T cell functionality

  • 51Cr-release cytotoxicity assays: These evaluate the ability of T cells to kill target cells expressing gD2, providing insights into cell-mediated cytotoxicity

  • ELISA: For measuring antibody titers and isotypes against gD2

  • MHC binding assays: These determine how gD2-derived peptides interact with different HLA types, informing epitope selection for vaccine design

  • Flow cytometry: For phenotyping T cell subsets responding to gD2 stimulation

  • Neutralization assays: To evaluate the functional capacity of antibodies to prevent viral entry

Each assay provides distinct and complementary information about the immune response to gD2. For comprehensive evaluation, researchers should employ multiple assays to assess both humoral and cell-mediated immunity. Additionally, correlation analyses between immunological parameters and clinical outcomes can identify potential correlates of protection, which are crucial for predicting vaccine efficacy .

How do post-translational modifications affect gD2 immunogenicity?

Post-translational modifications (PTMs) significantly impact gD2 immunogenicity through several mechanisms. When expressed in eukaryotic systems like the baculovirus-Sf9 cell system, gD2 undergoes glycosylation and other modifications that more closely resemble the native viral protein than when expressed in prokaryotic systems . These modifications influence:

  • Protein folding and tertiary structure, affecting epitope presentation

  • Protein stability and half-life in circulation

  • Recognition by pattern recognition receptors

  • Processing and presentation by antigen-presenting cells

  • Binding affinity to MHC molecules

For optimal immunogenicity, researchers should select expression systems that provide appropriate PTMs. The baculovirus-Sf9 system has proven effective for producing biologically active gD2 with proper modifications . When evaluating recombinant gD2 preparations, researchers should assess glycosylation patterns and other PTMs through techniques such as mass spectrometry and compare them with the native viral protein to ensure similarity. Differences in PTMs between recombinant and native gD2 may explain variations in vaccine efficacy and should be carefully considered when interpreting experimental results.

What are the current challenges in achieving complete protection with gD2-based vaccines?

Despite the promise of gD2 as a vaccine candidate, several challenges limit achieving complete protection:

  • Epitope variability: While gD2 contains multiple immunodominant epitopes, recognition patterns vary between individuals, and some epitopes show sequence divergence between HSV-1 and HSV-2

  • Incomplete immune activation: gD2 alone may not stimulate all necessary components of protective immunity, particularly tissue-resident memory T cells

  • Viral immune evasion mechanisms: HSV-2 employs multiple strategies to evade immune detection and clearance

  • Latency establishment: Even with partial protection against disease, preventing viral latency remains challenging

  • Population variability: Differential effectiveness observed between HSV-1 seronegative and seropositive individuals complicates universal application

Current research indicates that while recombinant gD2 vaccines have shown partial protection (>70%) in clinical trials, complete protection remains elusive . Future approaches may need to combine gD2 with additional viral antigens or novel adjuvants to enhance protective efficacy. Additionally, targeting multiple stages of the viral life cycle through combination vaccines may be necessary to overcome the sophisticated immune evasion mechanisms employed by HSV-2.

How can computational approaches enhance gD2-based vaccine design?

Computational approaches offer powerful tools for enhancing gD2-based vaccine design through:

  • Epitope prediction algorithms: These can identify potential T and B cell epitopes within gD2, prioritizing those likely to be immunodominant across diverse HLA backgrounds

  • Structural biology integration: Molecular modeling of gD2 can identify conserved regions essential for viral function that may serve as ideal targets for neutralizing antibodies

  • Immunoinformatics: Population-level HLA distribution analysis can guide epitope selection to maximize coverage across diverse populations

  • Protein engineering: Computational design can optimize gD2 constructs by enhancing stability, immunogenicity, and expression efficiency

  • Systems biology approaches: Integrating transcriptomic, proteomic, and immunological data can identify correlates of protection and guide rational vaccine design

By applying these computational tools, researchers can rationalize the design process, reducing the need for extensive trial-and-error experimentation. This approach is particularly valuable given the complex immunodominant epitope landscape of gD2, where multiple epitopes (two to six per individual) have been identified, with variable recognition patterns across individuals . Computational approaches can help identify optimal epitope combinations and design multivalent vaccines that elicit broad protection across diverse populations.

How should data tables be prepared for NIH grant applications focused on gD2 research?

Preparing data tables for NIH grant applications focused on gD2 research requires adherence to specific formatting guidelines. As of April 2025, all current applications must use FORMS-I data tables as specified by NIH guidelines . When preparing these tables:

  • Access the blank tables, instructions, and samples from the NIH Grants & Funding website

  • Focus on presenting clear, compelling data that demonstrates previous success and future potential

  • For Institutional Research Training grant applications, include:

    • Previous trainee outcomes and productivity

    • Faculty research interests and funding related to gD2

    • Publication records showing expertise in HSV research

    • Preliminary data on gD2 expression, purification, and immunological properties

Tables should highlight key achievements, such as successful optimization of gD2 expression conditions (e.g., 15 mM glucose, 0.4 g/L glutamine, 40% DO yielding 192 mg/L protein) . Present data in a logical progression that tells a cohesive scientific story about your research program's capabilities and potential contributions to advancing gD2-based therapeutics or vaccines .

What interdisciplinary collaborations would enhance gD2 research?

Effective gD2 research benefits from strategic interdisciplinary collaborations:

  • Structural biologists: To determine high-resolution structures of gD2 and its complexes with receptors or antibodies

  • Immunologists: To characterize T and B cell responses to gD2 and identify correlates of protection

  • Virologists: To provide expertise on HSV-2 pathogenesis and viral life cycle

  • Bioprocess engineers: To optimize expression and purification conditions for recombinant gD2

  • Clinical researchers: To design and implement human trials of gD2-based vaccines

  • Computational biologists: To predict epitopes and model protein-protein interactions

  • Adjuvant specialists: To identify optimal adjuvant formulations for gD2 vaccines

Collaborative approaches facilitate more comprehensive investigations of complex challenges, such as understanding the basis for gD2 cross-recognition between HSV-1+/HSV-2− and HSV-1−/HSV-2+ subjects . Well-designed collaborations can accelerate progress by bringing diverse expertise to bear on the multifaceted challenges of developing effective gD2-based therapeutics and vaccines.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.