Recombinant Human herpesvirus 2 Envelope glycoprotein I (gI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gI; US7; Envelope glycoprotein I; gI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-372
Protein Length
full length protein
Species
Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)
Target Names
gI
Target Protein Sequence
LVVRGPTVSLVSDSLVDAGAVGPQGFVEEDLRVFGELHFVGAQVPHTNYYDGIIELFHYP LGNHCPRVVHVVTLTACPRRPAVAFTLCRSTHHAHSPAYPTLELGLARQPLLRVRTATRD YAGLYVLRVWVGSATNASLFVLGVALSANGTFVYNGSDYGSCDPAQLPFSAPRLGPSSVY TPGASRPTPPRTTTSPSSPRDPTPAPGDTGTPAPASGERAPPNSTRSASESRHRLTVAQV IQIAIPASIIAFVFLGSCICFIHRCQRRYRRPRGQIYNPGGVSCAVNEAAMARLGAELRS HPNTPPKPRRRSSSSTTMPSLTSIAEESEPGPVVLLSVSPRPRSGPTAPQEV
Uniprot No.

Target Background

Function

In epithelial cells, the gE/gI heterodimer is crucial for cell-to-cell viral spread. It directs nascent virions to cell junctions, facilitating rapid spread to adjacent cells via interactions with junctional cellular receptors. This is implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for anterograde spread throughout the nervous system. In conjunction with US9, gE/gI participates in sorting and transporting viral components to axon terminals. Furthermore, the gE/gI heterodimer acts as a receptor for the Fc region of human IgG. Dissociation at acidic pH suggests a role in interfering with host Ig-mediated immune responses, potentially via antibody bridging, endocytosis, and subsequent degradation.

Protein Families
Alphaherpesvirinae glycoprotein I family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What is the molecular composition and function of HSV-2 glycoprotein I?

HSV-2 glycoprotein I (gI) is encoded by the US7 gene and functions primarily as part of a heterodimeric complex with glycoprotein E (gE). This complex serves multiple critical functions in HSV-2 pathogenesis:

  • In epithelial cells, the gE/gI heterodimer is required for cell-to-cell spread of the virus by sorting nascent virions to cell junctions

  • In neuronal cells, gE/gI is essential for the anterograde spread of infection throughout the host nervous system

  • Together with US9, the heterodimer facilitates sorting and transport of viral structural components toward axon tips

  • The heterodimer serves as a receptor for the Fc domain of human IgG, with dissociation occurring at acidic pH

The heterodimer plays a significant role in immune evasion through a process called antibody bipolar bridging, followed by intracellular endocytosis and degradation, which interferes with host Ig-mediated immune responses .

How does the genetic organization of the US7 region relate to gI expression?

The HSV-2 US7 gene encoding gI is located in the unique short (US) region of the viral genome, adjacent to the US8 gene encoding gE. When amplified for research purposes, a common approach is to generate a fragment spanning from 57 bp upstream of the US7 start codon to include its regulatory elements . The genomic organization is as follows:

GeneProteinGenomic LocationNotable Features
US7gIUnique short regionForms heterodimer with gE
US8gEUnique short regionForms heterodimer with gI
US9US9 proteinUnique short regionWorks with gE/gI for axonal transport

PCR amplification of this region typically yields a 3,182-bp segment that includes the complete US7 gene, the intergenic region, and the US8 gene .

What are optimal expression systems for producing functional recombinant HSV-2 gI?

Several expression systems have been successfully employed for producing recombinant HSV-2 gI, each with distinct advantages:

Eukaryotic baculovirus expression system:
The baculovirus/Spodoptera frugiperda (Sf9) expression system has proven highly effective for producing glycoproteins in their properly folded and post-translationally modified forms. Research indicates that high-density cell culture optimization can significantly improve yields:

ParameterOptimized ValueEffect on Yield
Glucose concentration15 mMEnhanced cell density
Glutamine concentration0.4 g/LImproved protein expression
Dissolved oxygen (DO)40%Maximized cell viability

Under these optimized conditions, Sf9 cell density can reach 9.6×10^6 cells/mL with recombinant glycoprotein yields up to 192 mg/L .

Mammalian cell expression:
For studies requiring authentic glycosylation patterns that closely mimic those in human infection, mammalian expression systems (HEK293, CHO) are preferred. When co-expressing gI with gE, a vector design incorporating a strong promoter (such as CMV) for each gene, separated by an IRES element or using separate vectors, provides better heterodimer formation .

What methodologies are most effective for analyzing gE/gI heterodimer formation and Fc-binding activity?

Surface Plasmon Resonance (SPR):
SPR has been established as the gold standard for studying protein-protein interactions between gE/gI and IgG Fc domains. Key methodological considerations include:

Research has demonstrated that while soluble gE-2 alone is incapable of binding human IgG or the IgG Fc domain, co-expression with gI-2 and purification of the gE-2/gI-2 heterodimer enables binding to human IgG through its Fc domain .

Size Exclusion Chromatography (SEC):
SEC combined with multi-angle light scattering (SEC-MALS) provides valuable information about heterodimer formation, stoichiometry, and stability. Typical running conditions include:

  • Buffer: PBS pH 7.4

  • Flow rate: 0.5 mL/min

  • Detection: UV absorbance at 280 nm coupled with light scattering

What amino acid residues are critical for gI function and heterodimer formation?

Research using site-directed mutagenesis has identified several key regions in both gI and gE that are critical for heterodimer formation and Fc binding:

ProteinRegionFunctionEffect of Mutation
gE-2Surface-exposed Fc:gE-2 interfaceIgG Fc bindingNine identified mutations abrogated or reduced Fc binding while maintaining heterodimer formation with gI
gI-2N-terminal regionHeterodimer formationMutations disrupt heterodimer assembly

Interestingly, gE-2 mutants with reduced Fc binding capacity maintain the ability to form heterodimers with gI, indicating that these functions are structurally distinct .

How does recombinant gI distribution on virions contribute to the fusion and entry process?

Super-resolution microscopy studies have revealed important insights into glycoprotein distribution on HSV virions:

  • Most glycoproteins, including gB, gH/gL, and gC are distributed evenly around purified virions

  • In contrast, glycoprotein distribution patterns change significantly upon cell binding

  • This redistribution of glycoproteins upon cell attachment may contribute to initiating the cascade of activations leading to membrane fusion

While these studies primarily examined HSV-1, they provide valuable methodological approaches that can be applied to studying HSV-2 gI distribution:

  • Purify virions through sucrose gradient ultracentrifugation

  • Label using specific antibodies against gI and other glycoproteins

  • Analyze using super-resolution techniques like STORM or PALM

  • Compare glycoprotein distribution patterns between cell-free and cell-bound virions

How does genetic diversity in HSV-2 gI compare to other viral glycoproteins?

Phylogenetic analyses of HSV-2 glycoproteins have revealed important patterns of diversity:

This differential evolutionary rate between gI and gE suggests that gI function is more tightly constrained during viral evolution.

What methods are most effective for detecting recombination events in genes encoding HSV-2 gI?

Several complementary computational approaches have been used to detect recombination in HSV-2 genes:

MethodDescriptionApplicationsDetection Power
PHI testIdentifies recombination signal in phylogenetic networksStatistical detection of recombinationProvides p-values; <0.05 considered positive for recombination
GARDIdentifies putative breakpoints within aligned nucleic acid sequencesLocalization of recombination breakpointsDetermines specific locations of recombination
RDPUses nine pairwise scanning approachesComprehensive recombination detectionReports number of approaches that detected recombination
Bootscan analysis (Simplot)Visualizes recombination patternsIdentification of recombinant segmentsGenerates visual evidence of recombination

While HSV-2 generally shows less evidence of recombination than HSV-1, recombination has been detected within continents and much less frequently between continents in both strains .

How can recombinant HSV-2 gI/gE heterodimers be utilized for vaccine development?

The gE/gI heterodimer represents a promising vaccine target, but its Fc-binding activity can potentially mask functional epitopes and affect its immunogenicity. Research has shown that:

  • A series of gE-2 mutations within the surface-exposed Fc:gE-2 interface can abrogate or reduce Fc binding while maintaining heterodimer formation with gI

  • Vaccinating with Fc-binding deficient gE-2/gI-2 heterodimers elicited comparable anti-heterodimer binding antibody titers and statistically significantly higher serum neutralization antibody levels than wildtype heterodimers

Methodological approach for designing improved gE/gI-based vaccines:

  • Design mutations in gE-2 based on structural knowledge of the Fc:gE-2 interface

  • Co-express mutant gE-2 with wildtype gI-2

  • Evaluate heterodimer formation and Fc binding by SPR

  • Assess immunogenicity in animal models measuring both binding and neutralizing antibodies

What are the challenges in developing diagnostic tests based on HSV-2 gI?

Diagnostic tests using HSV glycoproteins face several challenges:

  • Some serological tests fail to differentiate HSV-1 from HSV-2, especially in East Africa, with specificity as low as 50.7%

  • Sequences from African HSV-2 isolates contain unique amino acid signatures in glycoproteins G, I, and E, which may account for the failure of sensitive antibody tests

Consensus sequences generated from diverse global populations can be used to improve diagnostic assays that differentiate HSV-1 from HSV-2 . When developing gI-based diagnostics, researchers should:

  • Include sequences from multiple geographic regions in antigen design

  • Focus on conserved epitopes that show minimal variation across isolates

  • Consider using multiple glycoproteins (combination of gG, gI, and gE) to improve specificity

  • Validate assays against genetically diverse clinical isolates

This approach would help address the challenges posed by geographic variations in HSV-2 sequences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.