Recombinant Human herpesvirus 2 Envelope protein UL45 (UL45)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UL45; Envelope protein UL45; 18 kDa protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)
Target Names
UL45
Target Protein Sequence
MAFRASGPAYQPLAPAASPARARVPAVAWIGVGAIVGAFALVAALVLVPPRSSWGLSPCD SGWQEFNAGCVAWDPTPVEHEQAVGGCSAPATLIPRAAAKHLAALTRVQAERSSGYWWVN GDGIRTCLRLVDSVSGIDEFCEELAIRICYYPRSPGGFVRFVTSIRNALGLP
Uniprot No.

Target Background

Function
A crucial virulence factor contributing to HSV neurotropism. It appears necessary for glycoprotein B-induced fusion but dispensable for in vitro growth.
Database Links

KEGG: vg:1487332

Protein Families
Herpesviridae HHV-1 UL45 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is HSV-2 UL45 and what are its fundamental structural properties?

Herpes simplex virus type 2 (HSV-2) UL45 is a 172-residue protein with a molecular mass of approximately 18-20 kDa. It is characterized as an integral membrane protein that lacks asparagine-linked carbohydrates despite having membrane-spanning capabilities. The protein shares approximately 75% sequence identity with its HSV-1 counterpart (UL45-1) .

Kyte and Doolittle hydropathy analysis reveals that UL45-2 contains a potential membrane-spanning sequence between residues 24 and 48, which is critical for its membrane association . Unlike the virus's eleven glycoproteins, UL45 belongs to a distinct class of HSV proteins that possess membrane-spanning segments but lack consensus sites for N-linked glycosylation .

Why is UL45's classification as a type II membrane protein significant?

UL45-2 holds the distinction of being the first identified HSV protein with a type II membrane orientation . This orientation means that the protein's N-terminus faces the cytoplasmic side while its C-terminus extends into the extracellular or luminal space. This structural arrangement has profound implications for its function and interactions with other viral and cellular components.

The type II orientation was confirmed through experimental approaches involving UL45 mutants with artificially introduced potential glycosylation sites . This distinctive membrane topology suggests unique functional roles in the viral replication cycle that differ from the more common type I membrane proteins found in HSV.

What are the recommended methods for confirming UL45's membrane orientation?

To confirm the type II membrane orientation of recombinant HSV-2 UL45, researchers should consider a multi-faceted experimental approach. The gold standard methodology involves creating mutant constructs with artificially introduced N-glycosylation sites at various positions throughout the protein sequence . Since glycosylation machinery is located in the ER lumen, only sites exposed to this compartment will become glycosylated.

A systematic experimental design should include:

  • Generation of UL45 mutants with potential glycosylation sites at both the presumed luminal and cytoplasmic domains

  • Expression in appropriate cell lines (such as CV1 cells used in original studies)

  • Analysis of glycosylation status through gel mobility shift assays with and without glycosidase treatment

  • Complementary protease protection assays where intact membrane vesicles are treated with proteases that can only access cytoplasmic domains

This comprehensive approach allows for definitive determination of protein topology across the membrane, which is crucial for understanding UL45's functional interactions .

What experimental design is most appropriate for studying UL45's role in cell-cell fusion?

When investigating UL45's potential role in cell-cell fusion events, a factorial experimental design is most appropriate as it allows researchers to evaluate multiple variables simultaneously . Based on existing research, UL45 appears at similar timepoints as fusion-associated glycoproteins gB and gD during infection, supporting its potential involvement in membrane fusion processes .

A robust experimental design should include:

FactorLow Level (-)High Level (+)
UL45 ExpressionKnockout/SilencedWild-type/Overexpressed
Syncytial HSV-2 StrainNon-syncytialSyncytial
Cell TypeEpithelialNeuronal
Time Post-InfectionEarly (4-6h)Late (12-24h)

This two-level factorial design would require a minimum of 16 experimental conditions to properly assess main effects and interactions . Researchers should include appropriate controls and quantify fusion events using standardized metrics such as fusion index or luciferase reporter assays that measure cell content mixing.

Analysis of variance (ANOVA) should be employed to determine statistical significance, with careful attention to potential three-way interactions that might be missed in simplified experimental designs .

How should researchers design experiments to investigate UL45's temporal expression and localization during infection?

Investigating the temporal expression and localization of UL45 requires a carefully planned time-course study with appropriate markers and controls. Research has established that UL45-2 is detectable at approximately 4 hours post-infection (p.i.), similar to glycoprotein gC-2, while gB-2 and gD-2 are barely detectable at 2 hours p.i. .

A comprehensive experimental approach should include:

  • Infection of relevant cell lines (e.g., CV1, Vero, or human primary cells) at a controlled multiplicity of infection (MOI)

  • Collection of samples at regular intervals from 0 to 24 hours post-infection

  • Parallel tracking of UL45 and known viral glycoproteins (gB, gD, gC) using specific antibodies

  • Subcellular fractionation to determine protein localization at each timepoint

  • Immunofluorescence microscopy with co-localization studies using organelle markers

Quantitative analysis should employ both western blotting with densitometry and qRT-PCR for transcript levels. The temporal relationship between UL45 expression and fusion events should be carefully documented to establish causality rather than mere correlation .

What methodological approaches can resolve contradictions in UL45 functional studies?

When researchers encounter contradictory findings regarding UL45 function across different experimental systems, a mixed-methodology approach is recommended to resolve these discrepancies . This approach combines the strengths of both qualitative and quantitative research methodologies to provide a more comprehensive understanding of complex biological phenomena.

A systematic resolution strategy should include:

  • Standardization of experimental conditions across different laboratory settings

  • Utilization of multiple cell types relevant to HSV-2 infection (epithelial, neuronal, immune cells)

  • Comparison of different HSV-2 strains to account for strain-specific variations

  • Development of UL45-null mutants with clean genetic backgrounds to avoid confounding effects

  • Complementation studies with UL45 variants to establish structure-function relationships

When analyzing contradictory data, researchers should employ meta-analytical techniques to identify variables that might explain discrepancies, such as cell type-specific factors, differences in viral strains, or variations in experimental conditions . This approach allows each methodology to counteract the weaknesses of the other while leveraging their respective strengths .

What are the optimal expression systems for producing recombinant HSV-2 UL45 protein?

The selection of an appropriate expression system for recombinant HSV-2 UL45 production depends on the experimental objectives and required protein characteristics. As an integral membrane protein with type II orientation, UL45 presents specific challenges for heterologous expression and purification .

For structural and functional studies requiring properly folded UL45, mammalian expression systems are generally preferred. The following expression strategies have demonstrated efficacy:

Expression SystemAdvantagesLimitationsApplications
Mammalian (HEK293T)Native folding, proper orientationHigher cost, lower yieldFunctional studies, protein-protein interactions
Baculovirus-InsectHigher yield than mammalian, post-translational modificationsComplex setup, potential glycosylation differencesStructural studies, antibody production
E. coli (with solubilization tags)High yield, cost-effectiveRequires refolding, lacks post-translational modificationsAntigenic studies, limited structural analysis
Cell-free systemsRapid expression, membrane mimetics possibleTechnical complexity, limited scaleInitial screening, mutational analysis

What purification strategies are most effective for maintaining UL45 stability and function?

Purifying integral membrane proteins like UL45 presents significant challenges due to their hydrophobicity and requirement for membrane environments. Based on experimental findings showing that UL45 is an integral membrane protein solubilizable with detergents like NP-40 , the following purification strategy is recommended:

  • Membrane isolation: Fractionate infected or transfected cells to isolate membrane components containing UL45

  • Detergent screening: Test multiple detergents (DDM, LMNG, NP-40) at various concentrations to optimize solubilization efficiency while maintaining protein stability

  • Affinity chromatography: Utilize N- or C-terminal affinity tags (His6, FLAG, etc.) for initial capture, considering the protein's type II orientation

  • Size exclusion chromatography: Remove aggregates and isolate homogeneous protein populations

  • Stability assessment: Monitor protein stability in various buffer conditions using thermal shift assays or limited proteolysis

Throughout the purification process, researchers should maintain conditions that preserve UL45's native conformation, potentially including lipids or lipid-like molecules to stabilize the transmembrane regions. For structural studies, consider reconstructing UL45 into nanodiscs or other membrane mimetic environments to maintain its native membrane context .

How can researchers investigate UL45's potential interactions with other viral glycoproteins?

Given UL45's temporal expression pattern similar to that of glycoproteins gB and gD, which are critical for viral entry and cell-cell fusion, investigating potential protein-protein interactions is essential for understanding its functional role . A comprehensive interaction study should employ multiple complementary approaches:

  • Co-immunoprecipitation assays with antibodies against UL45 and candidate interacting partners (gB, gD, gH/gL)

  • Proximity labeling techniques such as BioID or APEX2 to identify proteins in close proximity to UL45 during infection

  • Split reporter assays (split-GFP, split-luciferase) to monitor dynamic interactions in living cells

  • Surface plasmon resonance or microscale thermophoresis to determine binding kinetics with purified components

  • Cryo-electron microscopy of complexes containing UL45 and other viral membrane proteins

When designing these experiments, researchers should consider the type II membrane orientation of UL45, which places its C-terminal domain in the extracellular/luminal space where it could potentially interact with the ectodomains of viral glycoproteins involved in fusion .

What approaches are recommended for studying the role of UL45 in viral immune evasion?

While the primary research on UL45 has focused on its potential role in membrane fusion, its type II membrane orientation and temporal expression pattern suggest it may also participate in immune evasion strategies. To investigate this possibility, researchers should design experiments that examine:

  • UL45's effect on MHC-I and MHC-II presentation pathways through flow cytometry and immunofluorescence

  • Potential interference with complement activation or antibody recognition

  • Modulation of innate immune sensing pathways, particularly those detecting viral membrane fusion events

  • Alterations in cytokine responses in UL45-expressing versus non-expressing conditions

A mixed methodology approach combining quantitative measurements of immune activation markers with qualitative assessment of cellular responses would provide the most comprehensive understanding . Researchers should employ both UL45-null viruses and cells expressing UL45 in isolation to distinguish direct effects from those mediated by other viral factors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.