Recombinant Human herpesvirus 2 Glycoprotein K (gK)

Shipped with Ice Packs
In Stock

Description

Table 1: Comparative Features of HSV-1 and HSV-2 gK

FeatureHSV-1 gKHSV-2 gK
Length338 amino acids338 amino acids
Homology100% across strains ~84% vs. HSV-1
Glycosylation SitesN48, N58 Preserved (predicted)
Key Functional DomainsCytoplasmic domain III Likely similar to HSV-1

2.1. Virion Morphogenesis and Egress

  • Envelopment: gK-UL20 interaction is required for cytoplasmic virion envelopment. Deletion of gK in HSV-1 results in nonenveloped capsid accumulation .

  • Egress Efficiency: HSV-1 ΔgK mutants show 10²–10⁶ reduced plaque counts, highlighting gK’s role in particle transport .

2.2. Viral Entry and Membrane Fusion

  • Entry Kinetics: HSV-1 gK-null virions exhibit delayed entry (3x slower than wild-type) .

  • Fusion Regulation: Syncytial mutations in gK cause extensive cell fusion, though gK itself does not localize to plasma membranes .

Table 2: Functional Impact of gK Deletion in HSV-1 (Inferred for HSV-2)

PhenotypeWild-Type HSV-1ΔgK Mutant
Plaque MorphologyNormal, non-syncytialMicroscopic, syncytial
Virion LocalizationEnveloped at trans-Golgi Cytoplasmic capsid accumulation
Entry EfficiencyRapid (60–90 min) Delayed (>180 min)

Immunopathological Implications

  • Immune Exacerbation: HSV-1 gK immunization in mice worsens corneal scarring and dermatitis via CD8+ T-cell responses .

  • Therapeutic Targets:

    • SPP Inhibition: Blocking gK-signal peptide peptidase (SPP) interactions with aspirin or L685,458 reduces viral spread .

    • Vaccine Design: Attenuated HSV-1 ΔgK mutants confer protection against HSV-2 challenge in murine models .

Research Challenges and Future Directions

  • Expression Systems: Recombinant gK is typically produced via baculovirus vectors, yielding 29–40 kDa glycosylated forms .

  • Structural Ambiguities: Conflicting localization reports (nuclear vs. cell surface) necessitate advanced imaging studies.

  • HSV-2 Specificity: Most data derive from HSV-1; functional studies on HSV-2 gK remain sparse but urgent for antiviral development.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development according to your specification.
Synonyms
gK; UL53; Envelope glycoprotein K; Syncytial protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-338
Protein Length
full length protein
Species
Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Target Names
gK
Target Protein Sequence
ASPLHRCIYAVRPAGAHNDTALVWMKINQTLLFLGPPTAPPGGAWTPHARVCYANIIEGR AVSLPAIPGAMSRRVMNVHEAVNCLEALWDTQMRLVVVGWFLYLAFVALHQRRCMFGVVS PAHSMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQTLVQLFEADPVTFLYH RPAIGVIVGCELLLRFVALGLIVGTALISRGACAITHPLFLTITTWCFVSIIALTELYFI LRRGSAPKNAEPAAPRGRSKGWSGVCGRCCSIILSGIAVRLCYIAVVAGVVLVALRYEQE IQRRLFDL
Uniprot No.

Target Background

Function
Glycoprotein that likely regulates membrane fusion events during the secondary envelopment of cytoplasmic capsids, which bud into specific trans-Golgi network (TGN)-derived membranes. It also plays a role, in conjunction with gB, in virus-induced cell-to-cell fusion (syncytia formation). It appears to inhibit the fusion of virions with infected-cell membranes.
Protein Families
Alphaherpesvirinae glycoprotein K family
Subcellular Location
Host cell membrane; Multi-pass membrane protein. Host endosome membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the amino acid sequence homology between HSV-1 gK and HSV-2 gK?

HSV-2 gK is 338 amino acids long, showing approximately 84% amino acid sequence homology with HSV-1 gK. This high degree of conservation suggests important functional roles for this glycoprotein across herpesvirus types . The sequence alignment studies demonstrate that gK from different alphaherpesviruses maintain varying degrees of homology: Macacine Herpesvirus 1 (McHV-1) shares 66% homology with HSV-1 gK, Bovine Herpesvirus 1 (BoHV-1) shares 33%, and Varicella zoster virus (VZV) shares 28% . The relatively high conservation between HSV-1 and HSV-2 gK proteins implies similar structural and functional properties in viral processes.

What are the primary structural domains of HSV-2 gK and their functions?

HSV-2 gK, like its HSV-1 counterpart, is structured with multiple domains that serve specific functions in viral processes. The protein contains four major domains (I-IV), with domains II and III located on the cytoplasmic side and domains I and IV positioned on the extracellular/luminal side . The amino terminus (domain I) of gK is particularly important as it interacts with the amino terminus of glycoprotein B (gB), facilitating virus entry and disease progression . Studies have identified specific functional elements within these domains:

  • N-linked glycosylation sites (N48 and N58) that affect virus-induced cell fusion and replication

  • Critical cysteine residues (C37 and C114) within the amino terminus that significantly impact virus production

  • Regions that mediate interactions with other viral proteins like UL20, facilitating proper virion assembly and egress

How does HSV-2 gK contribute to viral replication and pathogenesis?

HSV-2 gK plays multiple critical roles in viral replication and pathogenesis. Based on studies of HSV-1 gK which shares high homology with HSV-2 gK, this glycoprotein:

  • Regulates or facilitates viral egress from infected cells by mediating envelopment of viral particles

  • Influences fusion events during viral entry and cell-to-cell spread

  • Participates in the recruitment of other viral glycoproteins into virus assembly sites

  • Functions in conjunction with UL20 protein to facilitate proper trafficking of viral components

Without functional gK, viruses experience significant defects in egress, with nonenveloped capsids accumulating in the cytoplasm, demonstrating gK's essential role in the viral life cycle . Interestingly, research indicates that overexpression of gK can also cause defects in virus egress, suggesting that proper regulation of gK expression is necessary for optimal viral replication .

What expression systems are most effective for producing recombinant HSV-2 gK?

While the search results don't specifically address HSV-2 gK expression systems, insights can be gained from successful expression of related herpesvirus glycoproteins. The baculovirus expression system in Spodoptera frugiperda (Sf9) insect cells has proven effective for expressing HSV-2 glycoprotein D (gD2) . This system offers several advantages for herpesvirus glycoprotein expression:

  • Proper post-translational modifications including glycosylation

  • High expression levels under optimized conditions

  • Scalability for large-scale production

For HSV-2 gK expression, similar approaches could be employed, with optimization for this specific glycoprotein. The table below summarizes key parameters that would need optimization when expressing HSV-2 gK in the Sf9 baculovirus system:

ParameterOptimal RangeImpact on Production
Glucose concentration~15 mMSupports high-density cell growth
Glutamine concentration~0.4 g/LMaintains cell viability and productivity
Dissolved oxygen (DO)~40%Ensures proper protein folding and processing
Multiplicity of infection (MOI)Requires optimizationAffects timing and yield of protein expression
Harvest timeProtein-specificBalances yield and quality of target protein

These parameters have been successful for HSV-2 gD2 production, yielding up to 192 mg/L of recombinant protein in high-density culture .

What purification strategies are most effective for isolating recombinant HSV-2 gK while maintaining its native conformation?

Purification of recombinant HSV-2 gK requires strategies that preserve the protein's complex structure and functionality. While specific methods for HSV-2 gK aren't detailed in the search results, effective approaches for herpesvirus glycoproteins typically include:

  • Affinity chromatography using tags (His-tag, as seen with commercially available recombinant HSV proteins)

  • Size exclusion chromatography to separate properly folded proteins from aggregates

  • Ion-exchange chromatography for further purification

A critical consideration for HSV-2 gK purification is maintaining the native conformation of the protein, particularly its multiple transmembrane domains. This often requires:

  • Careful selection of detergents for membrane protein solubilization

  • Optimization of buffer conditions to maintain protein stability

  • Validation of structural integrity using biophysical techniques (circular dichroism, thermal shift assays)

  • Functional assessment of the purified protein

Researchers should verify that purified recombinant HSV-2 gK retains its ability to interact with known binding partners, such as UL20 or gB, as a measure of functional integrity.

How can researchers effectively study the interaction between HSV-2 gK and other viral glycoproteins?

Studying interactions between HSV-2 gK and other viral glycoproteins requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against gK or its potential binding partners to pull down protein complexes and identify interacting partners.

  • Proximity ligation assays: For visualizing protein-protein interactions in situ within infected cells.

  • Bimolecular Fluorescence Complementation (BiFC): To visualize and map interactions between gK and other viral proteins in living cells.

  • Recombinant viruses with epitope tags: Similar to the approach used with HSV-1, where recombinant viruses (e.g., gKV5DI, gKV5DII, gKV5DIII, and gKV5DIV) expressing V5 epitope tags in frame within different domains of gK were constructed . This strategy allows for domain-specific interaction studies.

  • Mutational analysis: Systematic mutation of specific residues in gK to identify regions critical for protein-protein interactions. For example, studies with HSV-1 gK identified that deletion of amino acids 31-68 within the amino terminus inhibits gB binding to Akt-1 and blocks virus entry .

Research has shown that HSV-1 gK interacts with signal peptide peptidase (SPP) with different affinities in different cell types . Similar approaches could be applied to study HSV-2 gK interactions, with careful consideration of cell type specificity.

What role does HSV-2 gK play in viral entry, and how can this process be experimentally assessed?

HSV-2 gK likely plays a critical role in viral entry similar to HSV-1 gK. Based on studies of HSV-1, the amino terminus of gK binds to the amino terminus of gB, which is essential for virus entry . This interaction facilitates the fusion of the viral envelope with host cell membranes, a crucial step in the infection process.

To experimentally assess HSV-2 gK's role in viral entry, researchers can employ:

  • Viral entry assays: Using reporter viruses or biochemical detection methods to quantify entry efficiency.

  • gK mutant viruses: Constructing HSV-2 viruses with specific mutations in gK domains to assess their impact on entry.

  • Cell-based fusion assays: Monitoring cell-cell fusion mediated by viral glycoproteins to isolate the fusion step from other aspects of viral entry.

  • Binding studies with purified proteins: Using surface plasmon resonance or other biophysical techniques to characterize direct interactions between purified gK and other glycoproteins involved in the entry process.

  • Domain-specific antibodies: Developing antibodies that recognize specific domains of gK to block interactions and assess their functional significance.

Particular attention should be paid to the N-terminal domain of HSV-2 gK, as studies with HSV-1 have shown that this region is crucial for interactions with gB and subsequent viral entry processes .

How does HSV-2 gK contribute to immune responses, and what are its implications for vaccine development?

HSV-2 gK likely plays significant roles in immune responses similar to HSV-1 gK. Studies with HSV-1 have shown that gK can exacerbate corneal scarring (CS) and dermatitis when used for immunization in infected mice . This suggests that gK may have immunopathological properties that need careful consideration in vaccine development.

Key immunological aspects of HSV-2 gK to consider:

  • Potential for enhancing immunopathology: If HSV-2 gK shares the exacerbating properties of HSV-1 gK, its inclusion in vaccines could potentially worsen disease outcomes in certain contexts.

  • Epitope mapping and T-cell responses: Understanding the specific epitopes within HSV-2 gK that elicit T-cell responses is crucial for predicting immunological outcomes.

  • Cross-protection potential: Research with HSV-1 has shown that intramuscular injection with an HSV-1 mutant virus lacking gK conferred significant protection against both HSV-1 and HSV-2 challenges in mice , suggesting that gK-deficient approaches might provide cross-protective immunity.

  • Recombinant protein approach: Similar to the successful development of recombinant gD2 protein that showed partial prophylactic immune function in genital herpes , recombinant HSV-2 gK could potentially be developed as a vaccine component or target.

While not specifically about HSV-2 gK, recent vaccine development efforts by GSK utilize recombinant protein adjuvanted approaches for HSV-2 therapeutic vaccines . This platform, which has proven successful for the related alphaherpesviruses vaccine Shingrix, could potentially be adapted for targeting gK-mediated immunity if appropriate.

What methods are most effective for assessing the immunogenicity and protective efficacy of recombinant HSV-2 gK in experimental models?

Assessing immunogenicity and protective efficacy of recombinant HSV-2 gK requires comprehensive approaches:

  • Animal models: The guinea pig model has been used successfully to evaluate HSV-2 recombinant gD2 vaccine candidates and would likely be suitable for gK studies. Mouse models are also frequently used, especially for immunological assessments.

  • Immune response assessment:

    • Humoral immunity: ELISA to measure antibody titers, neutralization assays to assess functional antibody responses

    • Cellular immunity: ELISpot or intracellular cytokine staining to measure T-cell responses

    • Innate immune activation: Cytokine profiling and innate immune cell phenotyping

  • Challenge studies: Following immunization, animals are challenged with virulent HSV-2 to assess:

    • Prevention of infection (complete protection)

    • Reduction in viral shedding (partial protection)

    • Mitigation of disease severity (therapeutic effect)

    • Prevention of establishment of latency (measured by PCR of ganglia)

  • Immune correlates of protection: Identifying specific immune parameters that correlate with protection, such as:

    • Neutralizing antibody titers above a certain threshold

    • Specific T-cell responses to key epitopes

    • Balance of Th1/Th2/Th17 responses

  • Comparative studies: Comparing recombinant HSV-2 gK with established vaccine candidates such as gD2-based vaccines to benchmark efficacy .

It's important to note that with HSV-1 gK, immunization has been shown to exacerbate corneal scarring in infected mice , suggesting that similar assessments for potential disease enhancement should be included in safety evaluations of HSV-2 gK-based immunogens.

How can gene editing techniques be applied to study HSV-2 gK function in viral replication and pathogenesis?

Modern gene editing techniques offer powerful approaches to study HSV-2 gK function:

  • CRISPR/Cas9 editing of viral genomes: Creating precise mutations or deletions in the gK gene to study specific functional domains. This approach allows for:

    • Single amino acid substitutions to study specific residues (e.g., the conserved cysteine residues or glycosylation sites)

    • Domain deletions to assess the role of specific regions

    • Promoter modifications to study the impact of gK expression levels

  • Bacterial artificial chromosome (BAC) mutagenesis: For larger-scale modifications of HSV-2 genomes, enabling:

    • Reporter gene insertion to track gK expression dynamics

    • Epitope tagging for tracking gK localization and interactions

    • Conditional expression systems to study gK function at specific stages of infection

  • Trans-complementation systems: Developing cell lines that express wild-type or mutant forms of gK to complement defects in gK-null viruses, similar to the approach used with HSV-1 gK-null mutants .

  • Inducible expression systems: Creating cell lines with inducible expression of wild-type or mutant gK to study dose-dependent effects, avoiding the complications observed with constitutive overexpression .

  • Single-cell analysis: Combining gene editing with single-cell transcriptomics or proteomics to understand cell-to-cell variation in gK function and its impact on viral outcomes.

These approaches could help resolve key questions about HSV-2 gK, such as its precise role in virion egress, the significance of its interactions with other viral proteins, and its contribution to pathogenesis in different tissue contexts.

What are the most promising approaches for developing HSV-2 gK-targeted antiviral strategies?

Several innovative approaches show promise for developing HSV-2 gK-targeted antivirals:

  • Small molecule inhibitors: Targeting critical gK-protein interactions, particularly:

    • gK-UL20 interactions that are essential for viral assembly and egress

    • gK-gB interactions that facilitate viral entry

    • gK-SPP interactions, which could be blocked by SPP inhibitors like aspirin, ibuprofen, or L685,458

  • Peptide-based inhibitors: Designing peptides that mimic interaction domains to competitively inhibit gK functions, such as:

    • Peptides mimicking the amino terminus of gK to block interaction with gB

    • Peptides targeting the domains involved in UL20 binding

  • Nucleic acid-based therapeutics:

    • siRNA or antisense oligonucleotides targeting gK mRNA

    • CRISPR-based approaches to disrupt gK expression or function in infected cells

  • Monoclonal antibodies: Developing antibodies that specifically recognize functional domains of gK exposed during the viral life cycle.

  • Structure-based drug design: As structural information about HSV-2 gK becomes available, rational design of inhibitors that target specific structural features could be pursued.

  • Combination approaches: Targeting gK in combination with other viral proteins, similar to the strategy using recombinant virus (VC2) with specific mutations in gK and UL20, which protected mice against HSV-1 and HSV-2 challenges .

  • Vaccine strategies: Contrary to direct inclusion of gK, developing vaccines based on gK-deficient viruses that have shown cross-protective immunity against both HSV-1 and HSV-2 .

Research should focus on approaches that target HSV-2 gK functions without affecting host proteins, and that are effective against both acute infection and viral reactivation from latency.

What are the main technical challenges in producing and working with recombinant HSV-2 gK, and how can they be addressed?

Working with recombinant HSV-2 gK presents several technical challenges:

  • Membrane protein expression: As a multi-pass transmembrane protein, gK is difficult to express in soluble form. Researchers can address this by:

    • Using specialized expression systems designed for membrane proteins

    • Creating soluble domain constructs that contain specific functional regions

    • Employing fusion partners that enhance solubility while maintaining function

  • Proper folding and post-translational modifications: gK contains N-linked glycosylation sites and disulfide bonds that are crucial for function . Strategies to ensure proper processing include:

    • Using eukaryotic expression systems like insect cells or mammalian cells

    • Optimizing culture conditions (glucose, glutamine, dissolved oxygen) as demonstrated for gD2 production

    • Including chaperones or folding enhancers in expression systems

  • Purification challenges: Maintaining native conformation during purification requires:

    • Careful selection of detergents or amphipols for membrane protein extraction

    • Optimized buffer conditions to maintain stability

    • Gentle purification procedures to preserve structural integrity

  • Functional assays: Verifying that recombinant gK retains native functionality can be addressed by:

    • Developing binding assays with known interaction partners like UL20 or gB

    • Creating cell-based assays that measure specific gK functions

    • Using structural and biophysical techniques to confirm proper folding

  • Antibody development: Creating specific antibodies against different domains of gK is challenging but essential. Approaches include:

    • Using synthetic peptides corresponding to specific domains for immunization

    • Developing conformation-specific antibodies using properly folded recombinant proteins

    • Creating domain-specific antibodies similar to those used for HSV-1 gK studies

How can researchers design experiments to differentiate between the functions of HSV-2 gK and other viral glycoproteins with overlapping roles?

Distinguishing the specific functions of HSV-2 gK from other viral glycoproteins requires strategic experimental approaches:

  • Domain-specific mutants: Creating viruses with targeted mutations in specific domains of gK while leaving other glycoproteins intact. This allows for:

    • Mapping of domain-specific functions

    • Identification of residues critical for specific processes

    • Understanding of how specific domains contribute to interactions with other viral proteins

  • Complementation assays: Testing whether defects in gK-null viruses can be rescued by other viral glycoproteins, or vice versa, to identify unique versus redundant functions.

  • Temporal expression studies: Controlling the timing of gK expression relative to other glycoproteins to understand their sequential roles in the viral life cycle.

  • Binding partner analysis: Comprehensive identification of all proteins that interact with gK compared to other glycoproteins, using techniques such as:

    • Proximity labeling approaches (BioID, APEX)

    • Cross-linking mass spectrometry

    • Co-immunoprecipitation followed by mass spectrometry

  • High-resolution microscopy: Tracking the localization and movement of gK relative to other glycoproteins during different stages of infection using:

    • Super-resolution microscopy techniques

    • Live-cell imaging with fluorescently tagged proteins

    • Correlative light and electron microscopy

  • Combined depletion approaches: Simultaneously targeting multiple glycoproteins to identify synergistic or antagonistic functional relationships.

For example, studies have shown that gM plays a major role in synergy with gK/UL20 in the incorporation of gD and gH/gL into mature virions . Such studies help delineate the cooperative functions of different glycoproteins in viral processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.