Recombinant Human herpesvirus 2 Ribonucleoside-diphosphate reductase small chain (UL40)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Herpesvirus 2 Ribonucleoside-Diphosphate Reductase Small Chain (UL40)

Recombinant Human Herpesvirus 2 Ribonucleoside-diphosphate reductase small chain (UL40) refers to a protein derived from the human herpesvirus 2 (HHV-2), also known as herpes simplex virus 2 (HSV-2) . UL40 is the small subunit of the ribonucleoside-diphosphate reductase enzyme . This enzyme is crucial for DNA synthesis, as it catalyzes the formation of deoxyribonucleotides from ribonucleotides .

Characteristics

CharacteristicDescription
Protein NamesRibonucleoside-diphosphate reductase small chain, R2 subunit
EC Number1.17.4.1
Alternative NamesRibonucleotide reductase 38 kDa subunit, Ribonucleotide reductase small subunit
Gene NamesUL40
ORF NamesUL40
Expression Region1-337 amino acids
AA SequenceMDPAVSPASTDPLDTHASGAGAAPIPVCPTPERYFYTSQCPDINHLRSLSILNRWLETELVFVGDEEDVSKLSEGELGFYRFLFAFLSAADDLVTENLGGLSGLFEQKDILHYYVEQECIEVVHSRVYNIIQLVLFHNNDQARRAYVARTINHPAIRVKVDWLEARVRECDSIPEKFILMILIEGVFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVHTTASCYIYNNYLGGHAKPEAARVYRLFREAVDIEIGFIRSQAPTDSSILSPGALAAIENYVRFSADRLLGLIHMQPLYSAPAPDASFPLSLMSTDKHTNFFECRSTSYAGAVVNDL

Function and Significance

  1. DNA Synthesis: Ribonucleoside-diphosphate reductase, of which UL40 is a subunit, is essential for converting ribonucleotides to deoxyribonucleotides, a critical step in DNA replication and repair .

  2. Immune Evasion: UL40 plays a role in helping the virus evade the host's immune system. Specifically, it can protect cells infected with human cytomegalovirus (HCMV) from being killed by natural killer (NK) cells . UL40 mediates this evasion by interacting with CD94/NKG2A receptors on NK cells .

Research Findings

  1. NK Cell Evasion: Studies have demonstrated that UL40 expression during HCMV infection can induce protection against NK cell attack . Deletion of UL40 in HCMV mutants results in the virus being more susceptible to NK cell-mediated killing .

  2. Vaccine Development: The RR2 protein, which includes ribonucleoside-diphosphate reductase, has shown promise as a subunit vaccine against recurrent genital herpes in preclinical studies . Vaccines based on RR2 have been found to reduce virus shedding and the severity of recurrent lesions, correlating with an increase in functional T cells at the site of infection .

  3. T Cell Response: Research indicates that UL40 can stimulate T cell responses, with multifunctional CD4 T cell subsets being promoted by vaccination with UL40 and specific adjuvants .

Therapeutic Potential

  1. Antiviral Target: Given its role in DNA synthesis, UL40 represents a potential target for antiviral therapies. Inhibition of UL40 function could disrupt viral replication .

  2. Vaccine Component: As part of the RR2 protein, UL40 has shown promise in subunit vaccines against HSV-2, offering a potential strategy for therapeutic mucosal vaccination .

Recombinant Production

Recombinant UL40 protein is produced using recombinant DNA technology, where the UL40 gene is expressed in a host organism such as E. coli . The recombinant protein can then be purified and used for research purposes, such as studying its structure, function, and interactions with other molecules .

Related Research

  1. UL20 as an Antiviral Target: Ribozymes targeting the UL20 gene of herpes simplex virus type 1 (HSV-1) have demonstrated potential as a therapeutic strategy for inhibiting HSV infection .

  2. UL42 Function: The herpes simplex virus type 1 UL42 gene product functions as a subunit of DNA polymerase to increase processivity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RIR2; UL40; Ribonucleoside-diphosphate reductase small subunit; Ribonucleotide reductase small subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Target Names
RIR2
Target Protein Sequence
MDPAVSPASTDPLDTHASGAGAAPIPVCPTPERYFYTSQCPDINHLRSLSILNRWLETEL VFVGDEEDVSKLSEGELGFYRFLFAFLSAADDLVTENLGGLSGLFEQKDILHYYVEQECI EVVHSRVYNIIQLVLFHNNDQARRAYVARTINHPAIRVKVDWLEARVRECDSIPEKFILM ILIEGVFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVHTTASCYIYNNYLGGHAKPE AARVYRLFREAVDIEIGFIRSQAPTDSSILSPGALAAIENYVRFSADRLLGLIHMQPLYS APAPDASFPLSLMSTDKHTNFFECRSTSYAGAVVNDL
Uniprot No.

Target Background

Function

The ribonucleoside-diphosphate reductase holoenzyme provides essential precursors for viral DNA synthesis. It enables viral replication in non-dividing cells and reactivation from latency in infected hosts. Its function is to catalyze the biosynthesis of deoxyribonucleotides from their corresponding ribonucleotides.

Database Links

KEGG: vg:1487327

Protein Families
Ribonucleoside diphosphate reductase small chain family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the structural composition of HSV-2 ribonucleotide reductase and how is UL40 characterized?

HSV-2 ribonucleotide reductase (RR) consists of two heterologous protein subunits. The small subunit (RR2) is a 38-kDa protein encoded by the UL40 gene . This protein functions as part of the viral enzymatic machinery required for viral DNA synthesis. The heterodimeric structure of RR is essential for proper catalytic activity, with the UL40-encoded small chain playing a crucial role in substrate binding and specificity. The UL40 gene product contains regions that are highly conserved across herpesviruses, which suggests evolutionary importance of this protein's function .

What is the primary function of the UL40 gene product in HSV-2 replication?

The UL40 gene product serves as the small subunit (RR2) of the viral ribonucleotide reductase enzyme, which is involved in the conversion of ribonucleotides to deoxyribonucleotides, a critical step in viral DNA synthesis. Interestingly, despite its role in replication, experimental evidence shows that UL40 appears to be dispensable for in vitro virus replication. When a UL40 deletion mutant (ΔUL40) was generated and tested, it replicated as efficiently as the parent virus and with similar growth kinetics . This suggests that while UL40 contributes to viral replication, the host cell may provide compensatory mechanisms in an in vitro setting, or other viral factors may have redundant functions.

How does UL40 contribute to HSV-2 immune evasion mechanisms?

UL40 plays a significant role in viral immune evasion, particularly against Natural Killer (NK) cells. Research has demonstrated that UL40 expression during productive viral infection contributes to protection against CD94/NKG2A+ NK cell cytolysis . In experimental settings, deletion of UL40 (ΔUL40) resulted in increased killing of infected cells by NK cells compared to cells infected with wild-type virus. Primary NK cell lines showed significantly enhanced cytotoxicity against ΔUL40-infected targets compared with AD169 (wild-type)-infected fibroblasts . This protective mechanism appears to involve interactions with MHC class I molecules, as evidenced by the reversal of AD169-induced inhibition of NK line killing by anti-CD94 and anti-MHC I monoclonal antibodies .

What experimental approaches are most effective for analyzing UL40 protein interactions with host immune components?

When investigating UL40 protein interactions with host immune components, researchers should implement a multi-technique approach. In vitro cytotoxicity assays are essential for evaluating NK cell interactions with UL40-expressing cells. These assays have demonstrated variable effects including both inhibition and enhancement of NK killing of infected cells .

For analyzing specific interactions with immune receptors like CD94/NKG2A, researchers should employ:

  • NK cytotoxicity assays against virus-infected fibroblasts (using both wild-type and ΔUL40 mutants)

  • Flow cytometry to characterize immune cell populations

  • Blocking experiments using monoclonal antibodies against relevant receptors (e.g., anti-CD94, anti-MHC I)

  • Co-immunoprecipitation to identify direct protein-protein interactions

Researchers should establish primary NK cell lines for autologous experiments to avoid allogeneic reactions. In published studies, significant increases in killing were observed against ΔUL40-infected targets compared with wild-type virus-infected fibroblasts, and antibody blocking experiments reversed virus-induced inhibition of NK killing by >50% in most cases .

How can contradictory data on UL40's role in NK cell evasion be reconciled in experimental design?

Data contradictions regarding UL40's role in NK evasion can be addressed through careful experimental design that accounts for several key variables:

  • Cell type variability: Different fibroblast or NK cell sources may yield varying results. Research should utilize multiple cell lines and primary cells.

  • Viral strain differences: Genetic variations between viral strains can affect UL40 functionality. Studies should compare results across different HSV-2 strains.

  • Temporal considerations: The timing of measurements is critical, as UL40's effects may vary during different stages of infection. A comprehensive time-course analysis should be implemented.

  • NK cell subset heterogeneity: Different NK cell subpopulations may respond differently to UL40. Researchers should characterize NK cells based on receptor expression (particularly CD94/NKG2A status).

  • Threshold determination: Establishing appropriate thresholds for positive results is essential. As noted in contradiction probability research, threshold selection significantly impacts interpretation .

A structured experimental approach that systematically tests variables while controlling for confounding factors allows researchers to identify the specific conditions under which UL40 mediates NK evasion, thus reconciling seemingly contradictory observations.

What are the critical variables to control when designing experiments involving UL40 and T cell responses?

When designing experiments to study UL40 and T cell responses, researchers must control several critical variables to ensure reliable, reproducible results:

Variable CategorySpecific FactorsControl Methods
T Cell VariablesSubset composition (CD4+/CD8+)Flow cytometry phenotyping
Activation statusStandardized isolation protocols
Exhaustion markers (PD-1, TIM-3)Marker screening before experiments
Viral FactorsViral strainUse well-characterized laboratory strains
MOI (multiplicity of infection)Standardize across experiments
Time post-infectionEstablish consistent time points
Experimental SystemCulture conditionsStandardize media, supplements, temperature
Antigen presentationUse consistent APC populations
Adjuvant selectionStandardize adjuvant type and concentration

Research has shown that the UL40-encoded RR2 protein, when delivered with CpG and alum adjuvants, boosts neutralizing antibodies and enhances numbers of functional IFN-γ-producing CRTAM+ CFSE+ CD4+ and CD8+ TRM cells . These cells express low levels of PD-1 and TIM-3 exhaustion markers and localize to healed sites of the vaginal mucocutaneous tissues. In vivo depletion studies have demonstrated that both CD4+ and CD8+ T cells are critical for the observed protection, as depletion of either significantly abrogated the protective effect .

How should researchers design a controlled experiment to evaluate UL40's immunogenic properties?

Designing a controlled experiment to evaluate UL40's immunogenic properties requires a systematic approach following these steps:

  • Define variables:

    • Independent variable: UL40 protein formulation (e.g., concentration, adjuvant combination)

    • Dependent variables: Antibody titers, T cell responses, protection against challenge

    • Extraneous variables: Age, sex, previous exposure to herpesvirus

  • Formulate testable hypotheses:

    • "Recombinant UL40 protein delivered with CpG and alum adjuvants will elicit stronger neutralizing antibody responses than delivery with other adjuvant combinations"

    • "UL40 immunization will increase the number of tissue-resident memory T cells at mucosal sites"

  • Design experimental treatments:

    • Control group: Adjuvant-only or irrelevant protein with same adjuvant

    • Experimental groups: Multiple UL40 formulations with varying adjuvants

    • Delivery routes: Compare intramuscular vs. mucosal (e.g., intravaginal) delivery

  • Subject assignment:

    • Use random assignment to treatment groups

    • Consider between-subjects design for initial efficacy

    • Use within-subjects design for longitudinal immune monitoring

  • Measurement protocols:

    • Antibody responses: Neutralization assays, ELISA, epitope mapping

    • T cell responses: Flow cytometry for phenotyping (including exhaustion markers PD-1 and TIM-3)

    • Protection assessment: Viral challenge followed by monitoring of symptoms, viral shedding

Research has demonstrated that RR2 protein delivered either intramuscularly or intravaginally with CpG and alum adjuvants effectively boosts neutralizing antibodies that cross-react with both gB and gD, while enhancing functional T cell responses .

What methodological approaches can be used to analyze UL40's interactions with the host cell machinery?

To comprehensively analyze UL40's interactions with host cell machinery, researchers should employ multiple complementary methodological approaches:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling techniques (BioID, APEX)

    • FRET or BRET for real-time interaction dynamics

  • Structural biology approaches:

    • X-ray crystallography of UL40 alone and in complex with binding partners

    • Cryo-electron microscopy for larger complexes

    • NMR for flexible regions and dynamic interactions

  • Functional genomics:

    • CRISPR-Cas9 screens to identify host factors required for UL40 function

    • RNAi knockdown of candidate interacting partners

    • Expression profiling before and after UL40 expression

  • Cellular localization studies:

    • Immunofluorescence microscopy with cellular compartment markers

    • Live-cell imaging with fluorescently tagged UL40

    • Subcellular fractionation followed by Western blotting

  • Computational approaches:

    • Molecular docking simulations

    • Sequence-based interaction prediction

    • Evolutionary analysis of co-evolving residues

By integrating these approaches, researchers can build a comprehensive understanding of how UL40 interacts with and potentially manipulates host cell processes, particularly those related to immune evasion mechanisms involving NK cells .

How can tissue-resident memory T cell responses to UL40 be accurately measured in experimental systems?

Accurate measurement of tissue-resident memory (TRM) T cell responses to UL40 requires specialized techniques that preserve tissue architecture and cell phenotypes while providing quantitative and functional data:

  • Tissue processing and cell isolation:

    • Enzymatic digestion protocols optimized to maintain surface marker integrity

    • Mechanical dissociation techniques that minimize cell death

    • Density gradient separation to enrich for lymphocytes

  • Phenotypic characterization:

    • Multi-parameter flow cytometry panels including:

      • Core TRM markers: CD69, CD103, CXCR6

      • Functional markers: IFN-γ, CRTAM, CFSE

      • Exhaustion markers: PD-1, TIM-3 (preferably low expression)

    • Mass cytometry (CyTOF) for high-dimensional phenotyping

  • Spatial localization assessment:

    • Immunohistochemistry on tissue sections

    • Multiplexed immunofluorescence imaging

    • In situ hybridization for transcriptional profiling

  • Functional assays:

    • Ex vivo stimulation with UL40 peptides

    • Cytotoxicity assays against UL40-expressing targets

    • Cytokine production measurement by intracellular staining

  • In vivo assessment:

    • Adoptive transfer experiments with labeled T cells

    • In vivo depletion of specific T cell subsets (CD4+ or CD8+)

    • Viral challenge studies following immunization

Research has shown that protection against recurrent genital herpes correlates specifically with increased numbers of functional tissue-resident IFN-γ+ CRTAM+ CFSE+ CD4+ and IFN-γ+ CRTAM+ CFSE+ CD8+ TRM cells that infiltrate healed sites of the vaginal tissues . These cells express low levels of exhaustion markers and are critical for protection, as demonstrated by in vivo depletion studies.

How should researchers address contradictory findings regarding UL40's role in viral replication versus immune evasion?

Researchers facing contradictory findings regarding UL40's dual roles should implement a systematic approach to reconciliation:

  • Context-specific analysis: Separate experiments examining replication efficiency from those investigating immune evasion. Evidence shows that while UL40 deletion mutants (ΔUL40) can replicate efficiently in vitro with growth kinetics similar to parent virus , these same mutants show compromised ability to evade NK cell responses—suggesting context-dependent functions.

  • Cell-type considerations: Different cell types may reveal different UL40 functions. Fibroblasts may show minimal replication defects with ΔUL40 mutants while immune cell interaction experiments demonstrate clear immune evasion functions.

  • Temporal analysis: Examine UL40's functions across different time points post-infection. Early functions may prioritize replication while later functions focus on immune evasion.

  • Threshold determination: Establish appropriate significance thresholds for different experimental outputs. As noted in contradiction detection research, the probability threshold significantly impacts interpretation .

  • Mechanistic investigation: Determine if UL40's replication and immune evasion functions operate through distinct molecular mechanisms that can be separately modulated.

  • Structured comparison: Implement a formal utterance-based approach similar to dialogue contradiction detection by systematically comparing experimental conditions and outcomes across studies to identify the specific variables driving apparent contradictions.

When analyzing contradictory findings, researchers should recognize that UL40 likely has evolved multifunctional properties that may be regulated differently depending on the infection stage and cellular environment.

What are the most reliable experimental controls when studying UL40 in vaccination models?

When studying UL40 in vaccination models, implementing proper controls is crucial for valid interpretation of results. The following control elements should be incorporated:

  • Adjuvant-only control groups:

    • Administer the same adjuvant combination (e.g., CpG and alum) without UL40 antigen

    • Ensures observed effects are specific to UL40 and not adjuvant-induced immunomodulation

  • Irrelevant protein controls:

    • Include groups receiving non-HSV viral proteins with identical formulation

    • Controls for general protein-induced immune responses

  • Delivery method controls:

    • When comparing intramuscular versus intravaginal delivery, include both routes for all formulations

    • Controls for route-specific immune biases independent of antigen

  • Genetic knockout controls:

    • Include well-characterized UL40 deletion mutants (ΔUL40)

    • Compare with wild-type virus to distinguish UL40-specific effects

  • T cell depletion controls:

    • Perform selective depletion of CD4+ or CD8+ T cells in separate groups

    • Critical for attributing protection mechanisms, as research shows depletion of either significantly abrogates protection

  • Challenge dose standardization:

    • Validate viral challenge stock titers before each experiment

    • Ensure consistent challenge dose across experimental groups

  • Longitudinal sampling controls:

    • Include baseline (pre-vaccination) samples for each subject

    • Establish normal variation in immune parameters within the experimental population

These comprehensive controls allow researchers to definitively attribute observed effects to UL40-specific immune responses while minimizing confounding variables.

How can researchers effectively compare data across different experimental models of UL40 function?

To effectively compare data across different experimental models of UL40 function, researchers should implement a structured comparative framework:

  • Standardized reporting format: Develop and utilize a consistent reporting template that captures all key experimental variables including:

    • Cell types and passage numbers

    • Viral strains and preparation methods

    • Protein expression systems and purification protocols

    • Adjuvant compositions and concentrations

    • Detailed immunological readouts

  • Meta-analysis approach: Apply formal meta-analysis techniques when comparing across studies:

    • Calculate standardized effect sizes

    • Assess heterogeneity using I² statistics

    • Implement random-effects models when appropriate

    • Conduct sensitivity analyses based on study quality

  • Cross-validation strategies:

    • Test key findings across multiple model systems

    • Verify in vitro observations in relevant animal models

    • Translate animal model findings to human cell systems when possible

  • Comparative measurement benchmarks:

    • Establish reference standards for key assays (e.g., neutralizing antibody titers)

    • Include shared positive and negative controls across laboratories

    • Develop calibration curves for critical measurements

  • Structured contradiction analysis: Implement utterance-based approaches to formally evaluate contradictions between experimental outcomes :

    • Define contradiction probability thresholds

    • Compare maximum contradiction probabilities across experimental systems

    • Identify supporting evidence for contradiction decisions

Research has shown that UL40/RR2-based subunit vaccines provide protection comparable to live attenuated vaccines in animal models, with significant reductions in virus shedding and decreased severity and frequency of recurrent genital herpes lesions . This cross-model validation strengthens confidence in UL40's potential as a vaccine candidate.

What are the promising avenues for developing UL40-based therapeutic vaccines?

The development of UL40-based therapeutic vaccines represents a promising direction in HSV-2 research, with several specific avenues warranting further investigation:

  • Combination approaches: Explore synergistic potential of UL40/RR2 with other immunogenic HSV-2 proteins. Research has identified that among eight HSV-2 proteins tested, the envelope glycoprotein D (gD), tegument protein VP22, and RR2 produced significant protection against recurrent genital herpes . Combining these antigens may enhance protective efficacy.

  • Adjuvant optimization: Refine adjuvant combinations to specifically enhance tissue-resident memory responses. Studies have shown that RR2 protein delivered with CpG and alum adjuvants effectively boosts neutralizing antibodies and enhances functional T cell responses . Further optimization could improve mucosal immunity.

  • Immune checkpoint modulation: Investigate combining UL40 vaccination with immune checkpoint inhibitors. Research demonstrates that protective T cells express low levels of PD-1 and TIM-3 exhaustion markers , suggesting potential benefits from checkpoint inhibition.

  • Delivery system innovation: Develop novel delivery platforms that target vaginal mucocutaneous tissues. Both intramuscular and intravaginal delivery of RR2 with appropriate adjuvants have shown efficacy , but specialized delivery systems could enhance targeted immune responses.

  • Cross-reactive epitope engineering: Optimize UL40/RR2 constructs to enhance cross-reactivity with both gB and gD, as neutralizing antibodies from RR2 immunization have demonstrated this valuable property .

  • Correlates of protection validation: Further characterize and validate the specific T cell phenotypes (IFN-γ+ CRTAM+ CFSE+ CD4+ and CD8+ TRM cells) associated with protection to develop reliable immunological endpoints for clinical trials .

These approaches build upon the observation that UL40/RR2-based subunit vaccines have shown protection comparable to live attenuated vaccines like dl5-29 in reducing both virus shedding and recurrent disease .

How might advanced computational approaches enhance our understanding of UL40 interactions with host immunity?

Advanced computational approaches offer powerful tools to deepen our understanding of UL40 interactions with host immunity:

  • Structural prediction and modeling:

    • Use AlphaFold or RoseTTAFold to predict UL40 structure with high confidence

    • Perform molecular dynamics simulations to identify binding pockets

    • Model UL40 interactions with immune receptors like CD94/NKG2A

    • Simulate conformational changes during protein-protein interactions

  • Network analysis of host-pathogen interactions:

    • Construct protein-protein interaction networks centered on UL40

    • Identify hub proteins and critical nodes in immune evasion pathways

    • Compare network perturbations between wild-type and ΔUL40 infection

    • Integrate transcriptomic data to identify regulatory relationships

  • Machine learning for epitope prediction:

    • Train deep learning models on known T and B cell epitopes

    • Identify novel UL40 epitopes with high immunogenic potential

    • Predict cross-reactive epitopes with other HSV proteins (gB/gD)

    • Optimize epitope combinations for vaccine formulations

  • Systems biology integration:

    • Develop multi-scale models connecting molecular interactions to cellular responses

    • Simulate immune response dynamics following UL40 exposure

    • Predict vaccination outcomes across different host genetic backgrounds

    • Model the complex interplay between antibody and T cell responses

  • Natural language processing for literature mining:

    • Apply contradiction detection algorithms to identify knowledge gaps

    • Extract experimental conditions across multiple studies

    • Automatically generate structured research hypotheses

    • Identify patterns in experimental outcomes across the literature

These computational approaches can accelerate research by generating testable hypotheses, optimizing experimental design, and providing mechanistic insights into UL40's dual roles in viral replication and immune evasion .

What are the key considerations for translating UL40 research from animal models to human clinical applications?

Translating UL40 research from animal models to human clinical applications requires addressing several critical factors:

  • Cross-species homology assessment:

    • Evaluate structural and functional conservation of UL40 between animal models and human HSV-2

    • Compare immune recognition patterns across species

    • Identify species-specific differences in immune response mechanisms

  • Safety profile characterization:

    • Conduct comprehensive toxicology studies

    • Evaluate potential autoimmune reactions

    • Assess cross-reactivity with human proteins

    • Monitor for vaccine-associated enhanced disease potential

  • Immunological correlates validation:

    • Verify that protective T cell phenotypes (IFN-γ+ CRTAM+ CFSE+ TRM cells) identified in animal models are relevant in humans

    • Develop standardized assays for human samples

    • Establish threshold values associated with protection

  • Clinical trial design optimization:

    • Develop appropriate inclusion/exclusion criteria for HSV-2 positive individuals

    • Establish meaningful clinical endpoints (recurrence frequency, shedding, lesion severity)

    • Design sampling protocols to assess tissue-resident immune responses

    • Implement structured experimental approaches to address contradictions that may emerge

  • Manufacturing considerations:

    • Optimize recombinant UL40 expression systems for GMP production

    • Develop stability-indicating assays

    • Ensure lot-to-lot consistency

    • Establish appropriate adjuvant formulations for human use

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.