Recombinant Human herpesvirus 2 Virion egress protein UL34 (UL34)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NEC2; UL34; Nuclear egress protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Target Names
NEC2
Target Protein Sequence
MAGMGKPYGGRPGDAFEGLVQRIRLIVPATLRGGGGESGPYSPSNPPSRCAFQFHGQDGS DEAFPIEYVLRLMNDWADVPCNPYLRVQNTGVSVLFQGFFNRPHGAPGGAITAEQTNVIL HSTETTGLSLGDLDDVKGRLGLDARPMMASMWISCFVRMPRVQLAFRFMGPEDAVRTRRI LCRAAEQALARRRRSRRSQDDYGAVVVAAAHHSSGAPGPGVAASGPPAPPGRGPARPWHQ AVQLFRAPRPGPPALLLLAAGLFLGAAIWWAVGARL
Uniprot No.

Target Background

Function
Recombinant Human herpesvirus 2 Virion egress protein UL34 (UL34) plays a crucial role in virion nuclear egress, the initial step of virion release from infected cells. Within the host nucleus, UL34 interacts with the newly formed capsid via its vertices, directing it to the inner nuclear membrane through interaction with NEC2. It induces capsid budding at the inner nuclear membrane and subsequent envelopment within the perinuclear space. The UL34/NEC2 complex facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm where it reaches secondary budding sites in the Golgi apparatus or trans-Golgi network.
Database Links

KEGG: vg:1487320

Protein Families
Herpesviridae NEC2 protein family
Subcellular Location
Host nucleus inner membrane; Single-pass membrane protein.

Q&A

What is the UL34 protein in Human herpesvirus 2 (HSV-2)?

UL34 is a conserved viral membrane protein essential for herpesvirus egress from infected cells. In HSV-2, it functions as a tail-anchored type II membrane protein with molecular masses of 31 and 32.5 kDa (the latter being phosphorylated) . The protein is inserted into the viral envelope during primary envelopment at the inner nuclear membrane, playing a crucial role in viral particle maturation. UL34 forms a functional complex with UL31, and this interaction is essential for efficient nuclear egress of viral capsids. Studies with deletion mutants demonstrate that UL34 is required for viral replication, as UL34-null viruses show severely impaired growth and plaque formation .

Where is the UL34 protein localized during herpesvirus infection?

UL34 exhibits a dynamic localization pattern during HSV-2 infection. Immunofluorescence assays reveal that UL34 localizes primarily in a continuous net-like structure in the cytoplasm resembling the endoplasmic reticulum pattern . Additionally, the protein accumulates significantly at the nuclear membrane, particularly at the inner nuclear membrane where primary envelopment occurs. Confocal microscopy studies show that UL34 and UL31 colocalize at perinuclear regions in infected cells . Importantly, immune electron microscopy has demonstrated that UL34 is a component of enveloped virus particles within the perinuclear space but is absent from mature extracellular virions . This pattern of localization directly correlates with UL34's function in primary envelopment.

What is the role of UL34 in the herpesvirus replication cycle?

UL34 plays a critical role in the nuclear egress pathway of herpesviruses. Electron microscopy studies of UL34 deletion mutants reveal that viral morphogenesis proceeds normally through capsid assembly and DNA packaging, but nucleocapsids fail to undergo primary envelopment at the inner nuclear membrane . In the absence of UL34, no enveloped virus particles are observed in the cytoplasm or at the cell surface, and viral titers are reduced by 3-5 log orders of magnitude compared to wild-type virus . This phenotype demonstrates that UL34 is specifically required for the envelopment of capsids at the nuclear membrane, representing a critical step in viral maturation. The UL34 protein is expressed as a gamma-1 (leaky late) gene, with synthesis occurring at late times post-infection and being highly dependent on viral DNA replication .

How does UL34 interact with the viral protein UL31?

UL34 and UL31 form a critical functional complex during herpesvirus infection. Yeast two-hybrid studies have demonstrated direct physical interaction between these proteins . This interaction appears essential for the proper localization of both proteins at the nuclear membrane. In cells infected with UL34 deletion mutants, the UL31 protein becomes diffusely distributed throughout the nucleus rather than concentrating at the nuclear membrane . Conversely, in UL31-deletion mutants, UL34 function is compromised. Both proteins are components of perinuclear enveloped virions but are absent from mature virions, suggesting they function specifically in the nuclear egress pathway . The interdependence of these proteins indicates that their physical interaction is crucial for orchestrating the complex process of primary envelopment at the inner nuclear membrane.

What experimental approaches are most effective for studying UL34-UL31 interactions?

To comprehensively characterize UL34-UL31 interactions, researchers should employ multiple complementary approaches:

  • Yeast Two-Hybrid Analysis: Useful for mapping interaction domains and identifying specific amino acid residues required for binding. This approach successfully demonstrated direct interaction between UL31 and UL34 proteins in pseudorabies virus .

  • Co-Immunoprecipitation Assays: These can confirm interactions in infected cells under physiological conditions using antibodies against either UL31 or UL34.

  • GST Pull-Down Experiments: In vitro binding assays using recombinant proteins can validate direct protein-protein interactions and identify specific binding domains.

  • Confocal Microscopy with Co-localization Analysis: Using differentially labeled antibodies against UL31 and UL34 can reveal their spatial relationship in infected cells and determine whether specific mutations disrupt co-localization .

  • Proximity Ligation Assays: These provide increased sensitivity for detecting protein-protein interactions in situ with spatial resolution.

When interpreting interaction data, researchers should consider that the strength and characteristics of these interactions may vary depending on the experimental system and viral strain being studied.

How can researchers generate and validate UL34-null mutant viruses?

Generation and validation of UL34-null mutants requires careful methodology:

  • Construction Strategy:

    • Bacterial artificial chromosome (BAC) mutagenesis of the viral genome

    • Replacement of the UL34 coding sequence with a marker gene (e.g., GFP as used in HSV-1 studies)

    • Confirmation of the deletion by PCR, restriction analysis, and sequencing

  • Complementation System Development:

    • Creation of stably transfected cell lines expressing UL34 (e.g., 143/1099E cells)

    • Transfection with linearized plasmids containing UL34 under control of appropriate promoters

    • Selection with antibiotics (e.g., Geneticin at 400 μg/ml)

    • Isolation and screening of clonal cell lines for complementation ability

  • Validation Methods:

    • Western blot analysis using UL34-specific antisera to confirm absence of protein expression

    • Northern blot analysis to verify effects on mRNA expression of UL34 and flanking genes

    • Plaque assays comparing growth on complementing versus non-complementing cells

    • Single-step growth curves to quantify replication defects

    • Electron microscopy to analyze morphological defects in virion assembly and egress

  • Rescue Experiments:

    • Construction of repair viruses by restoring the UL34 gene to its original locus

    • Demonstration that the repair virus regains wild-type growth properties

Researchers should note that UL34-null mutants show cell-type dependent differences in plating efficiency, which may complicate interpretation of results .

What techniques are optimal for visualizing UL34 localization during different stages of viral infection?

For comprehensive visualization of UL34 localization throughout infection:

  • Immunofluorescence Microscopy:

    • Use of monospecific antisera against UL34

    • Counterstaining with markers for different cellular compartments (ER, nuclear membrane)

    • Nuclear chromatin staining (e.g., with propidium iodide) to define nuclear boundaries

    • Time-course experiments to track localization changes during infection progression

  • Confocal Microscopy:

    • Provides high-resolution imaging to distinguish nuclear membrane association

    • Co-localization studies with other viral proteins (e.g., UL31, glycoproteins)

    • Z-stack imaging to visualize three-dimensional distribution

  • Immune Electron Microscopy:

    • Gold-labeled antibodies to precisely locate UL34 at the ultrastructural level

    • Can distinguish between inner and outer nuclear membrane localization

    • Essential for detecting UL34 in perinuclear enveloped virions

  • Subcellular Fractionation:

    • Biochemical separation of nuclear, cytoplasmic, and membrane fractions

    • Western blot analysis of fractions to quantify distribution

For optimal results, researchers should combine these approaches with appropriate controls, including UL34-null mutants and markers for different cellular compartments.

How does phosphorylation affect UL34 function, and what methods can detect these modifications?

In HSV-2, UL34 exists in two forms: a 31 kDa unmodified form and a 32.5 kDa phosphorylated form . To study this post-translational modification:

  • Detection Methods:

    • Phosphate Labeling: Culture infected cells with 32P-orthophosphate and immunoprecipitate UL34

    • Phosphatase Treatment: Compare electrophoretic mobility before and after phosphatase treatment

    • Phos-tag SDS-PAGE: Enhanced separation of phosphorylated from non-phosphorylated forms

    • Mass Spectrometry: For precise identification of phosphorylation sites

  • Functional Analysis Approaches:

    • Site-Directed Mutagenesis: Convert potential phosphorylation sites (serine/threonine residues) to alanine (phospho-null) or aspartic acid (phospho-mimetic)

    • Kinase Inhibitor Studies: Use specific inhibitors to block potential kinases and observe effects on UL34 function

    • Complementation Assays: Test whether phosphorylation-site mutants can rescue replication of UL34-null viruses

  • Functional Consequences to Investigate:

    • Effects on UL31-UL34 interaction

    • Impact on membrane association

    • Influence on nuclear envelope localization

    • Role in primary envelopment process

Interestingly, while HSV-2 UL34 is phosphorylated, the homologous protein in pseudorabies virus appears to lack phosphorylation, suggesting virus-specific differences in post-translational modification patterns .

What are the challenges in distinguishing primary from secondary envelopment when studying UL34?

Distinguishing between primary nuclear envelopment and secondary cytoplasmic envelopment presents several technical challenges:

  • Ultrastructural Similarities:

    • Both processes involve membrane wrapping around capsids

    • Similar morphology at certain stages can confound interpretation

    • Requires high-resolution electron microscopy to differentiate

  • Experimental Approaches to Overcome These Challenges:

    • Immunogold Labeling: Using antibodies against UL34 (primary envelope) and tegument proteins like UL49 (secondary envelope)

    • Serial Section EM or Tomography: For three-dimensional reconstruction of envelopment events

    • Biochemical Fractionation: Isolation of perinuclear virions versus mature virions

    • Marker Analysis: UL34 is present in perinuclear virions but absent from mature virions, while UL49 (a major tegument protein) is not detectable in perinuclear virions but present in mature particles

  • Interpretive Considerations:

    • Different protein composition of primary versus secondary enveloped virions provides a biochemical means of differentiation

    • Partial envelopment events at the inner nuclear membrane may be confused with other membrane interactions

    • Cell fixation and processing for EM can alter membrane structures

Researchers should employ multiple complementary approaches and appropriate controls when studying these processes to avoid misinterpretation.

How can researchers quantitatively assess the impact of UL34 mutations on viral egress?

Quantitative assessment of UL34 function requires multi-parameter analysis:

  • Virus Production Quantification:

    • Single-step Growth Curves: Measure intracellular and extracellular virus at multiple timepoints

    • Plaque Size Analysis: Automated measurement of plaque area and cell number

    • Virus Particle Counting: Quantitative electron microscopy to count particles in different compartments

    • Quantitative PCR: Measure viral DNA in nuclear versus cytoplasmic fractions

  • Subcellular Distribution Analysis:

    • Quantitative Immunofluorescence: Measure relative amounts of viral proteins in different compartments

    • Cell Fractionation with Western Blotting: Quantify viral proteins in nuclear versus cytoplasmic fractions

    • Flow Cytometry: Measure surface expression of viral glycoproteins as indicator of successful egress

  • Advanced Imaging Approaches:

    • Automated Image Analysis: High-throughput quantification of viral particles in different compartments

    • Electron Tomography: 3D reconstruction of nuclear membrane modifications and budding events

  • Specific Metrics to Consider:

    • Ratio of enveloped to non-enveloped capsids in the nucleus

    • Percentage of nuclear membrane showing primary envelopment events

    • Rate of virus appearance in the cytoplasm versus extracellular space

    • Efficiency of nuclear egress relative to total capsid production

These quantitative approaches enable precise characterization of how specific UL34 mutations affect different stages of viral egress and can reveal subtle functional defects that might be missed by qualitative assessment alone.

What methodological approaches can be used to study UL34's membrane topology?

Understanding UL34's membrane topology is crucial for elucidating its function:

  • Protease Protection Assays:

    • Treat intact virions, infected cells, or cellular fractions with proteases

    • Compare protease sensitivity of different domains

    • Use domain-specific antibodies to determine protected regions

    • Include detergent controls to disrupt membrane barriers

  • Biochemical Fractionation Approaches:

    • Differential centrifugation to separate membrane-bound from soluble proteins

    • Carbonate extraction to distinguish integral from peripheral membrane proteins

    • Density gradient fractionation to separate different membrane compartments

  • Protein Modification Analysis:

    • Biotinylation assays for surface-exposed domains

    • Cysteine accessibility methods to probe membrane topology

  • Mutational Analysis:

    • Deletion or substitution of putative membrane-spanning domains

    • Creation of chimeric proteins with known membrane proteins

    • Systematic mutation of hydrophobic regions

    • Analysis of topology-altering mutations on virus replication

These approaches have collectively supported the model that UL34 is inserted into viral and cellular membranes as a tail-anchored type II membrane protein, with its C-terminus playing a critical role in membrane association and proper subcellular localization .

What are the experimental considerations when studying UL34 in different cell types?

Research has revealed important cell type-dependent differences in UL34 function:

  • Cell Type Selection Considerations:

    • Permissivity differences: UL34 deletion viruses show different plating efficiencies on Vero versus HEL299 cells

    • Nuclear architecture variations: Different cell types have different nuclear membrane structures

    • Cell division rates: Impact on nuclear envelope breakdown and reformation

    • Species specificity: Human versus animal cells may show different interactions with viral proteins

  • Experimental Design Approaches:

    • Comparative growth curves: Quantify replication in multiple cell types

    • Plaque morphology analysis: Compare plaque size and morphology across cell lines

    • Cell-type specific complementation: Test if cellular factors can partially complement UL34 function

    • Nuclear architecture analysis: Compare nuclear lamina structure in different cell types

  • Technical Control Measures:

    • Standardize infection conditions: Adjust MOI based on cell-specific permissivity

    • Account for cell-specific kinetics: Different cells may have different temporal progression

    • Control for cell confluence: Nuclear architecture changes with cell density

    • Validate antibodies: Antibody reactivity may vary between cell types

  • Data Interpretation Considerations:

    • Cell-type specific phenotypes may reveal functional domains of UL34

    • When results differ between cell types, consider cell-specific factors that might influence UL34 function

    • Recognize constraints when generalizing findings from one cell type to others

These considerations are particularly important when comparing results across different studies or when translating findings to physiologically relevant systems.

How can complementation assays be optimized when working with UL34 mutants?

Effective complementation systems are crucial for studying UL34 mutants:

  • Cell Line Development Optimization:

    • Promoter selection: Use promoters that provide appropriate expression levels

    • Selection method: Optimize antibiotic concentration (e.g., 400 μg/ml Geneticin) for stable transfectants

    • Clone screening: Test multiple independent clones for complementation efficiency

    • Expression verification: Confirm UL34 expression by Western blot and immunofluorescence

  • Complementation System Design:

    • Inducible expression systems: Allow controlled timing of UL34 expression

    • Tagged versus untagged proteins: Consider whether tags might interfere with function

    • Domain complementation: Express specific domains to map functional regions

    • Heterologous complementation: Test UL34 proteins from related herpesviruses

  • Assay Optimization:

    • Plaque size quantification: Measure multiple parameters (diameter, area, cell number)

    • Growth curve analysis: Compare single-step versus multi-step growth

    • Fluorescence-based assays: Use reporter genes (e.g., GFP) for high-throughput screening

  • Validation Approaches:

    • Rescue viruses: Create revertant viruses to confirm phenotype specificity

    • Trans-complementing plasmids: Test complementation by transient expression

    • Time-course experiments: Establish temporal requirements for UL34 function

The development of stable complementing cell lines, such as the 143/1099E cell line described for UL34-null HSV-1, provides a powerful system for detailed functional studies of UL34 mutations .

How do the functions of UL34 compare between different herpesvirus family members?

Comparative analysis of UL34 across herpesviruses reveals important insights:

  • Functional Conservation and Divergence:

    • Core functions: Nuclear egress role is conserved across alpha-, beta-, and gammaherpesviruses

    • Phenotypic similarities: UL34 deletion mutants in HSV-1, HSV-2, and PrV all show nuclear retention of capsids

    • Protein interactions: UL31-UL34 interaction is conserved across herpesvirus subfamilies

    • Sub-family specific features: May have acquired additional functions in specific virus lineages

  • Experimental Approaches for Comparative Analysis:

    • Complementation assays: Test if UL34 from one virus can complement deletion in another

    • Chimeric proteins: Create fusion proteins with domains from different viral UL34 homologs

    • Conserved domain mapping: Identify functionally essential regions through alignment and mutagenesis

    • Interaction partner comparison: Compare binding profiles with UL31 and other proteins

  • Specific Comparative Examples:

    • HSV-1 vs. HSV-2: Both UL34 proteins have similar functions but different molecular weights

    • HSV vs. PrV: Despite evolutionary distance, UL34 function in nuclear egress is conserved

    • Post-translational modifications: HSV-2 UL34 is phosphorylated while PrV UL34 shows no evidence of phosphorylation

    • Cellular localization patterns: May show virus-specific differences in precise subcellular distribution

These comparative approaches can reveal both fundamental conserved functions of UL34 and virus-specific adaptations, providing insights into herpesvirus evolution and potential targets for broad-spectrum antiviral strategies.

What is the relationship between UL34 and the nuclear lamina during herpesvirus infection?

The interaction between UL34 and the nuclear lamina is critical for herpesvirus nuclear egress:

  • Experimental Approaches to Study This Relationship:

    • Immunofluorescence microscopy: Co-localization of UL34 with lamina components

    • Biochemical fractionation: Association of UL34 with nuclear matrix fractions

    • Proximity labeling: Identifying direct interactions with lamina proteins

    • Phosphorylation analysis: Examining changes in lamin phosphorylation in presence/absence of UL34

  • Functional Studies:

    • Lamin disruption assays: Measure nuclear lamina integrity in presence/absence of UL34

    • Mutagenesis: Identify UL34 domains responsible for lamina interactions

    • Live cell imaging: Track dynamics of lamina rearrangements during infection

    • Electron microscopy: Visualize ultrastructural changes in nuclear lamina at sites of primary envelopment

  • Mechanistic Considerations:

    • UL31/UL34 complex may recruit cellular kinases that phosphorylate lamins

    • Local disruption of the nuclear lamina may be necessary for capsid access to the inner nuclear membrane

    • UL34's membrane association may help position viral capsids for budding at the inner nuclear membrane

    • The interaction with the nuclear lamina may differ between cell types, potentially explaining cell-type dependent effects

Understanding this relationship provides insight into how herpesviruses modify cellular structures to facilitate viral egress.

What are the current challenges and future directions in UL34 research?

Despite significant progress in understanding UL34 function, several challenges and opportunities remain:

  • Current Technical Challenges:

    • Capturing the dynamic process of nuclear egress in real-time

    • Determining the precise mechanism by which UL34/UL31 facilitates primary envelopment

    • Understanding the molecular basis of UL34's membrane-deforming properties

    • Resolving the structure of UL34 in its membrane-associated state

  • Emerging Research Directions:

    • Systems biology approaches: Integrating UL34 function into comprehensive models of viral egress

    • High-resolution structural studies: Cryo-electron tomography of UL34 in membrane context

    • Cellular factor identification: Comprehensive analysis of host factors interacting with UL34

    • Comparative virology: Detailed comparison of nuclear egress mechanisms across herpesviruses

    • Antiviral development: Targeting the UL31/UL34 interaction as a broad-spectrum approach

  • Methodological Advances:

    • Application of super-resolution microscopy to nuclear egress

    • Development of in vitro reconstitution systems for viral nuclear egress

    • CRISPR/Cas9 approaches to study host factors involved in UL34 function

    • Advanced computational modeling of membrane deformation during envelopment

These research directions will provide deeper insights into the fundamental mechanisms of herpesvirus nuclear egress and may reveal new targets for antiviral intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.