Recombinant Human herpesvirus 6A Glycoprotein U20 (U20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, if you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
U20; EJLF3; Glycoprotein U20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-422
Protein Length
Full Length of Mature Protein
Species
Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Target Names
U20
Target Protein Sequence
LPAKLYIKTTLAERIGKLQTVIGIDNDIVFAYERLYEDLTLLNHTVVGETLFDLTGSLEE GKNSTVDRFLGHVVIREFHRLHAGLQYVSLRNFSVSELVCFVNNNTQLSGSYVFLAGNTT YVQIDLFNENRGFVHDLINLSSFLQNRSLHVLSFYARRFCVEDILNFYGKVVFGDSRHRP PQVFSKRDTGLLVCTARRYRPIGTNIQWSIQNQTVSDDHMTDDFIRTEIAGQLLYSYERA LSRALSMTQRNFSCEITHKLLVTPALLTREDAFSFKGFVNPVKQSEDMFPRHNFPAPHRK KFNKLQLLWIFTVIPIAAGCMFVYMLTRYILFFVSGGCSLNPNRVLKRRRRNDEVPMVIM EVEYCNYEADDYMELHSVQKVRDNSIAVVCGNNSFDIERQSKISRNF
Uniprot No.

Target Background

Database Links

KEGG: vg:1487956

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Human Herpesvirus 6A Glycoprotein U20?

U20 is a membrane-spanning viral glycoprotein encoded by the U20 open reading frame in Human Herpesvirus 6A (HHV-6A). This protein functions as a viral immune evasion molecule and is exclusively found in roseoloviruses including HHV-6A, HHV-6B, and HHV-7, with no known homologues in other herpesviruses, including the betaherpesvirus HCMV . Bioinformatic analysis predicts U20 to be a membrane protein with a single membrane-spanning α-helix (amino acids 319-340) and an N-terminal signal peptide (amino acids 1-15) for endoplasmic reticulum sorting to the plasma membrane .

What are the structural characteristics of U20?

U20 is a 75-kDa membrane-spanning protein with several key structural features:

Structural FeatureDescriptionLocation (amino acids)
Signal peptideDirects ER sorting to plasma membrane1-15
Immunoglobulin chain C-like foldPotential protein interaction domain182-288
Transmembrane α-helixSingle membrane-spanning region319-340
N-glycosylation sitesMultiple predicted sitesN-terminal side only
Structural organizationHighly organized N-terminal, disordered C-terminalN/A

The protein is predicted to have an N-terminal extracellular domain and a C-terminal intracellular domain, with N-glycosylation sites exclusively on the N-terminal side of the membrane . Structural modeling strongly suggests that HHV-6B U20 is a virally-encoded Major Histocompatibility Complex protein homolog (vMHC) .

How is U20 expressed during viral infection?

U20 is expressed with early-like kinetics during HHV-6B infection. PCR analysis using U20-specific primers has demonstrated that U20 mRNA is transcribed during both productive infections (in MOLT3 cells) and nonproductive infections (in HCT116 cells) . This is consistent with microarray and PCR studies that have identified U20 as an early gene in HHV-6B .

Where is U20 localized in infected cells?

The cellular localization of U20 differs between HHV-6A and HHV-6B:

VirusLocalization PatternColocalizationEvidence Method
HHV-6APunctate pattern with lysosomal localizationStrong colocalization with lamp2 (Pearson's coefficient: 0.699)Recombinant U20-mCherry fusion protein, 3D superresolution imaging
HHV-6BPunctate pattern distinct from lysosomes or GolgiMinimal colocalization with Golgi marker giantin (Pearson's coefficient: 0.152)Immunofluorescence

In HHV-6A-infected cells, U20-mCherry fusion protein localizes in puncta and shows striking co-localization with the lysosomal membrane protein lamp2, but not with the Golgi membrane protein giantin . In contrast, HHV-6B U20 localizes in puncta distinct from lysosomes or Golgi .

How does U20 traffic through the cell?

U20 acquires several post-translational modifications as it traffics through the secretory system to the cell surface . Western blot analysis of cell fractions has shown U20 in the membrane fraction, sometimes appearing as a double band. This may represent differentially glycosylated forms of the protein in the outer cell membrane versus internal membranes . The presence of an N-terminal signal peptide suggests that U20 enters the secretory pathway via the endoplasmic reticulum before reaching its final destination in cellular membranes .

How does U20 contribute to viral immune evasion?

U20 contributes to viral immune evasion through at least two distinct mechanisms:

  • Inhibition of TNFR1 signaling (HHV-6B): U20 inhibits tumor necrosis factor receptor 1 (TNFR1) signaling, blocking both proinflammatory and proapoptotic pathways. This inhibition prevents PARP cleavage, caspase 3 and 8 activation, and IκBα Ser-32 phosphorylation downstream of TNFR1 .

  • Masking of ULBP1 from NKG2D recognition (HHV-6B): U20 binds directly to ULBP1, a MHC-like stress ligand recognized by the natural killer (NK) cell activating receptor NKG2D. This binding masks ULBP1 from detection by NKG2D, potentially inhibiting NK cell-mediated killing of infected cells .

These mechanisms help the virus evade host immune responses, allowing for continued infection and viral persistence.

What is the mechanism of U20 binding to ULBP1?

HHV-6B U20 glycoprotein binds directly to ULBP1, a mechanism that differs from previous suggestions that U20 leads to ULBP1 degradation. The binding of U20 to ULBP1:

  • Occludes the expected binding site on ULBP1 for NKG2D, as shown by structural modeling guided by small-angle X-ray scattering (SAXS) data

  • Inhibits both cellular and soluble NKG2D binding to ULBP1-expressing cells

  • Blocks NKG2D-mediated NK cell activation

  • Competes with anti-ULBP1 antibodies, with as little as 0.125 μM soluble U20 sufficient to reduce antibody binding by 60%

This suggests that rather than degrading ULBP1, U20 masks it from detection, representing a novel immune evasion strategy.

How does U20 inhibit TNFR1 signaling?

U20 is both necessary and sufficient for inhibiting TNFR1 downstream signaling during HHV-6B infection. Experimental evidence demonstrates that:

  • HHV-6B infection inhibits PARP cleavage, caspase 3 and 8 activation, and IκBα Ser-32 phosphorylation downstream of TNFR1

  • U20 overexpression alone inhibits these same pathways

  • siRNA knockdown of U20 reverses the inhibition of TNFR signaling during HHV-6B infection

  • U20 is located at the cell membrane, positioning it to potentially interfere with receptor signaling

The inhibition of both inflammatory and apoptotic signaling pathways downstream of TNFR1 represents an important viral strategy to prevent immune-mediated elimination of infected cells.

What methods can be used to express recombinant U20 for research?

Based on published research, several approaches have been employed to study U20:

Expression SystemApplicationAdvantagesConsiderations
Recombinant virus with U20-mCherry fusionLocalization studiesNative viral context, visualization in live cellsRequires BAC system, complex virus engineering
Plasmid-based expressionOverexpression studiesSimpler than viral systems, allows mutation studiesMay not replicate native viral regulation
Soluble U20 productionBinding and competition assaysEnables biochemical studiesMay require optimization of expression and purification

For U20-mCherry fusion studies, researchers have utilized recombinant HHV-6A viruses expressing U20 with C-terminal mCherry tags . This approach allowed visualization of U20 localization in infected cells.

What techniques are effective for studying U20 localization?

Multiple complementary techniques have been used to study U20 localization:

  • Fluorescent fusion proteins: U20-mCherry fusion proteins enable visualization of U20 in live cells

  • 3D superresolution microscopy: Provides detailed imaging of U20 localization relative to cellular markers like lamp2 (lysosomal) and giantin (Golgi)

  • Colocalization analysis: Quantification using Pearson's correlation coefficients (e.g., U20-mCherry with lamp2: 0.699; with giantin: 0.152)

  • Cell fractionation and Western blotting: Confirms membrane localization and can reveal different glycosylation states

These complementary approaches provide robust evidence for the cellular localization and trafficking of U20 during infection.

How can the interaction between U20 and ULBP1 be experimentally demonstrated?

The interaction between U20 and ULBP1 has been demonstrated through several experimental approaches:

  • Flow cytometry competition assays: Pre-treatment of ULBP1-expressing cells with soluble U20 reduces anti-ULBP1 antibody binding in a dose-dependent manner

  • NKG2D binding inhibition: Both cellular and soluble U20 inhibit NKG2D binding to ULBP1-expressing cells

  • Structural modeling with SAXS data: Shows that the expected binding site on ULBP1 for NKG2D is occluded in the U20-ULBP1 complex

For researchers investigating this interaction, additional approaches could include co-immunoprecipitation, surface plasmon resonance, or structural determination by X-ray crystallography or cryo-EM.

How do contradictions in U20 literature need to be reconciled?

Current literature contains apparent contradictions regarding U20 function that require careful experimental design to reconcile:

  • ULBP1 degradation vs. masking: While earlier studies suggested that HHV-6A U20 results in degradation of ULBP1, recent research proposes that this observation might be due to competition between U20 and the anti-ULBP1 antibody used for detection . This highlights the importance of using multiple detection methods when studying protein-protein interactions.

  • Differential localization: The different localization patterns observed for HHV-6A U20 (lysosomal) versus HHV-6B U20 (non-lysosomal puncta) raise questions about potential functional differences that require investigation using comparable methodologies.

When designing experiments to resolve such contradictions, researchers should consider applying a structured approach to data quality assessment, potentially using the contradiction pattern notation (α, β, θ) described in biomedical informatics literature .

What is the evolutionary significance of U20 in roseoloviruses?

The U20 ORF is exclusive to HHV-6A, HHV-6B, and HHV-7 (roseoloviruses) with no known homologues in other herpesviruses, including HCMV . This distinctive evolutionary lineage raises several research questions:

  • What selective pressures drove the acquisition and conservation of U20 in roseoloviruses?

  • How have the functions of U20 diverged between HHV-6A, HHV-6B, and HHV-7?

  • Does the immunoglobulin-like domain in U20 suggest acquisition from the host genome or convergent evolution?

  • How do the different immune evasion functions of U20 (TNFR1 inhibition, ULBP1 masking) relate to its evolutionary history?

Comparative genomics, structural biology, and functional studies across different roseolovirus species could provide insights into these questions.

How might the structural homology between U20 and MHC molecules inform therapeutic strategies?

Structural modeling strongly suggests that HHV-6B U20 and U21 glycoproteins are virally-encoded Major Histocompatibility Complex protein homologs (vMHCs) . This structural homology has significant implications:

  • The evolution of viral MHC mimics suggests strong selective pressure to interfere with MHC-dependent immune pathways

  • Understanding the structural basis of U20's interactions with host proteins could facilitate the design of targeted therapeutics

  • The presence of an immunoglobulin-like domain in U20 raises the possibility of interaction with additional host proteins beyond those currently identified

Researchers could explore structure-based drug design targeting the U20-ULBP1 interface or other U20-mediated interactions as potential antiviral strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.