Recombinant Human herpesvirus 6A Glycoprotein U22 (U22)-VLPs

Shipped with Ice Packs
In Stock

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal blue ice packs. However, if you require shipping in liquid form, it must be shipped with dry ice. Please communicate with us in advance, as additional fees for dry ice and a dry ice box will be incurred.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Upon receipt, store the protein at -20°C/-80°C. Ensure to avoid repeated freezing and thawing, as this can negatively impact protein activity.
Shelf Life
The shelf life of the product is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you require a specific tag type, please inform us, and we will investigate the feasibility of developing it.
Synonyms
U22; EJLF1; Glycoprotein U22
Datasheet & Coa
Please contact us to get it.
Expression Region
21-202aa
Research Area
others
Source
Mammalian cell
Species
Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Target Names
U22
Target Protein Sequence
SLHIINNENSVFIATHSETELRHWLIFVKMAQRNGTAWWRMASVPINAYFERDIAFLFNPRCVIETAMGSKILCRYNKNIGVVFVDNDTKCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRKERRRFLSRCERFVYYCISVYLFAVVVLCSCWFALDPLFNMWA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the major immune evasion glycoproteins encoded by HHV-6A?

HHV-6A encodes several glycoproteins that modulate host immune responses. The viral genome contains a block of six genes (U20-U26) unique to the roseolovirus genus that are implicated in immune evasion . Among these, U20 and U21 are notable immunoevasins with structural modeling strongly suggesting they are viral homologs of Major Histocompatibility Complex proteins (vMHCs) . U20 targets ULBP1, a ligand for the NK cell activating receptor NKG2D, while U21 targets both HLA class I molecules and ULBP3 . These mechanisms help the virus evade recognition by both T cells and NK cells.

How does HHV-6A infection affect NKG2D ligand expression?

HHV-6A infection significantly alters the expression of NKG2D ligands on infected cells, which are crucial for NK cell recognition. Specifically, HHV-6A downregulates MICB, ULBP1, and ULBP3, while MICA and ULBP2 expression remains largely unaffected . The downregulation occurs rapidly, with significant reduction observed as early as 24 hours post-infection. This selective targeting of specific NKG2D ligands represents a strategic approach by the virus to evade NK cell surveillance while conserving viral coding space .

What are the structural characteristics of HHV-6A U20?

HHV-6A U20 is an integral membrane glycoprotein possessing a class I MHC-like fold . It undergoes several post-translational modifications, particularly to its N-linked glycans, which are characteristic of surface-expressed glycoproteins . Interestingly, U20 is also phosphorylated on at least one serine, threonine, or tyrosine residue. Despite sharing 92% identity with HHV-6B U20, the two proteins appear to have different functional roles in immune evasion .

What methodological approaches are used to study HHV-6A glycoprotein functions?

Researchers employ multiple complementary approaches to characterize HHV-6A glycoprotein functions:

  • Cell infection models using susceptible T cell lines (e.g., HSB-2 and J-Jhan) with the HHV-6A strain GS

  • Flow cytometry to quantify surface expression of target proteins at different time points post-infection

  • Recombinant protein expression systems to produce viral proteins for binding studies

  • Protein transduction into target cells to assess effects on immune ligand expression

  • CRISPR-Cas9 gene targeting to validate protein functions in the context of viral infection

  • Small-angle X-ray scattering (SAXS) for structural analysis of protein-protein complexes

What are the differences in immune evasion mechanisms between HHV-6A and HHV-6B glycoproteins?

What experimental challenges exist in studying HHV-6A glycoprotein-host interactions?

Several experimental challenges complicate the study of HHV-6A glycoprotein interactions:

  • Functional redundancy: Multiple viral proteins may target the same host pathways, making it difficult to attribute specific effects to individual glycoproteins .

  • Technical limitations in CRISPR-Cas9 applications: When targeting U20 and U21 using CRISPR-Cas9 in infecting viruses, researchers could only partially restore surface expression of their targets, possibly due to high viral load and propagation overwhelming the system or the existence of additional mechanisms targeting the same ligands .

  • Complex post-translational modifications: HHV-6A glycoproteins undergo various modifications including glycosylation and phosphorylation, which may affect their functions and complicate their structural and functional analysis .

  • Cell type-specific effects: The impact of glycoprotein expression varies between cell types, as demonstrated by the differential downregulation of ULBP1 in J-Jhan versus HSB-2 cells .

What are the methodological considerations for structural analysis of HHV-6A glycoprotein complexes?

Structural analysis of HHV-6A glycoprotein complexes requires specialized approaches:

  • SAXS analysis: Small-angle X-ray scattering provides low-resolution structural information about protein-protein complexes in solution and can guide molecular modeling approaches .

  • Machine learning-based modeling: Advanced computational methods can predict protein structures and their interactions, which can then be aligned with experimental SAXS data for validation .

  • Recombinant protein production: Expression systems must be optimized to produce glycoproteins with proper folding and post-translational modifications resembling those in viral infection .

  • Binding affinity measurements: Quantitative analysis of protein-protein interactions (such as U20-ULBP1) requires sensitive biophysical techniques to determine binding affinities and kinetics .

  • Functional validation: Structural models must be validated by functional assays, such as testing the ability of predicted interaction-disrupting mutations to restore NKG2D binding or NK cell activation .

How can researchers assess the impact of HHV-6A glycoproteins on NK cell functions?

To evaluate how HHV-6A glycoproteins affect NK cell functions, researchers can employ the following experimental approaches:

  • NK cell activation assays: Co-culture NK cells with target cells expressing individual viral glycoproteins (e.g., U20, U21) and measure activation markers or cytotoxic responses .

  • NKG2D-dependent killing assays: Compare NK cell-mediated cytotoxicity against control cells versus cells expressing viral glycoproteins, with and without NKG2D blocking antibodies to determine the contribution of the NKG2D pathway .

  • Flow cytometry analysis: Quantify surface expression of NKG2D ligands (MICA, MICB, ULBP1-3) on infected or transfected cells at different time points .

  • Receptor-ligand binding studies: Use recombinant soluble receptors (e.g., NKG2D-Fc) to measure binding to target cells in the presence or absence of viral glycoproteins .

  • CRISPR-Cas9 knockout approaches: Generate viral mutants lacking specific glycoprotein genes to determine their contribution to immune evasion phenotypes .

What approaches are effective for examining the temporal dynamics of HHV-6A glycoprotein expression?

To investigate the temporal dynamics of HHV-6A glycoprotein expression, researchers should consider:

  • Time-course infection studies: Infect susceptible cell lines and collect samples at multiple time points (e.g., 24, 48, 72 hours post-infection) for analysis of glycoprotein expression and host protein downregulation .

  • Pulse-chase experiments: Use metabolic labeling followed by immunoprecipitation to track the synthesis, maturation, and degradation of viral glycoproteins over time .

  • Live-cell imaging: Employ fluorescently tagged glycoproteins to monitor their localization and trafficking in real-time during infection or expression .

  • Quantitative PCR: Measure mRNA expression levels of viral glycoproteins at different stages of infection to understand transcriptional regulation .

  • Proteomic analysis: Apply mass spectrometry-based approaches to identify and quantify viral proteins and their post-translational modifications throughout the infection cycle .

How do HHV-6A glycoprotein immune evasion strategies compare to those of other herpesviruses?

HHV-6A glycoprotein immune evasion strategies share conceptual similarities with those of other herpesviruses but employ unique molecular mechanisms:

  • Targeting NKG2D ligands: Like HCMV, HHV-6A downregulates NKG2D ligands to evade NK cell surveillance, but it uses different viral proteins (U20, U21) compared to HCMV's UL16, UL142, and US18/US20 .

  • MHC-I downregulation: HHV-6A U21 targets MHC-I molecules for lysosomal degradation, a strategy also employed by other herpesviruses but through different molecular mechanisms .

  • Viral MHC homologs (vMHCs): U20 and U21 are predicted to be structural homologs of MHC proteins, a strategy used by multiple herpesviruses and poxviruses for immune modulation .

  • Balanced approach to NK cell evasion: HHV-6A simultaneously downregulates both MHC-I (which might activate NK cells through "missing self" recognition) and NKG2D ligands (preventing "induced self" recognition), achieving a comprehensive NK cell evasion strategy .

  • Conservation across related viruses: The targeting of the same NKG2D ligands by both HHV-6A and HHV-6B suggests evolutionary conservation of immune escape mechanisms between these closely related viruses .

What structural features distinguish HHV-6A U20 from other viral MHC homologs?

While detailed structural information on HHV-6A U20 is still emerging, several features distinguish it from other viral MHC homologs:

  • Binding mechanism: U20 binds directly to ULBP1 with sub-micromolar affinity, masking it from NKG2D recognition rather than causing its internalization or degradation .

  • Structural similarity to m152-RAE1γ complex: Modeling of the U20-ULBP1 complex indicates some similarities to the murine cytomegalovirus m152 protein complex with its target RAE1γ (a mouse NKG2D ligand) .

  • Post-translational modifications: U20 undergoes both glycosylation and phosphorylation, with the latter being less common among viral MHC homologs and potentially indicating additional regulatory mechanisms .

  • Dual functions: Unlike many viral MHC homologs with single immune evasion functions, HHV-6B U20 (92% identical to HHV-6A U20) has been implicated in both NKG2D ligand targeting and TNF receptor signaling inhibition .

  • Conservation within roseoloviruses: The U20-U26 gene cluster is unique to roseoloviruses, with no homologs in other herpesvirus subfamilies, suggesting distinct evolutionary adaptations in this virus genus .

What are promising therapeutic approaches targeting HHV-6A glycoprotein immune evasion mechanisms?

Several potential therapeutic approaches targeting HHV-6A glycoprotein immune evasion mechanisms deserve investigation:

  • Small molecule inhibitors: Develop compounds that disrupt the interaction between viral glycoproteins (e.g., U20) and their host targets (e.g., ULBP1), potentially restoring immune recognition of infected cells .

  • Peptide-based inhibitors: Design peptides mimicking the binding interfaces of key interactions to competitively inhibit viral protein function .

  • Monoclonal antibodies: Generate antibodies specifically targeting viral glycoproteins to neutralize their immune evasion functions or mark infected cells for immune clearance .

  • Gene editing approaches: Use CRISPR-Cas9 or similar technologies to disrupt viral immune evasion genes in the context of potential gene therapy for persistent infections .

  • Combination strategies: Target multiple viral immune evasion mechanisms simultaneously to overcome the redundancy built into the viral genome .

What technological advances would accelerate research on HHV-6A glycoprotein functions?

Several technological advancements would significantly enhance research on HHV-6A glycoprotein functions:

  • Improved structural analysis techniques: Higher-resolution methods for determining the structures of membrane glycoproteins and their complexes, particularly in their native membrane environment .

  • Advanced imaging approaches: Super-resolution microscopy and correlative light-electron microscopy to visualize viral protein trafficking and interactions within infected cells .

  • Efficient genetic manipulation systems: Better tools for genetic modification of HHV-6A to facilitate the study of glycoprotein functions in the context of viral infection .

  • Single-cell analysis methods: Technologies to examine the heterogeneity of glycoprotein expression and function at the single-cell level during infection .

  • In vitro organ models: Advanced organoid or tissue culture systems that better recapitulate the complexity of HHV-6A infection in human tissues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.