Recombinant Human herpesvirus 6A Glycoprotein U22 (U22)

Shipped with Ice Packs
In Stock

Description

Genetic Context and Functional Role

U22 is part of the Roseolovirus-specific gene cluster (U20–U26), which is implicated in immune modulation and viral persistence . Comparative genomic analysis reveals:

GeneFunction
U22Late gene glycoprotein; absent in HHV-7, involved in immune evasion
U20/U21MHC-I-like fold proteins that downregulate HLA-I antigen presentation
U24Inhibits T cell activation and cytokine secretion

While U22’s precise mechanistic role remains unclear, its inclusion in this cluster suggests contributions to viral tropism or immune evasion .

Production and Applications

Recombinant U22 is primarily used in:

  • Binding assays: Functional ELISA confirms its interaction with host cell receptors .

  • Antibody development: Immunogenic properties make it a candidate for diagnostic tools .

  • Structural studies: Despite challenges in eukaryotic post-translational modifications, it aids in epitope mapping .

Production involves codon-optimized E. coli expression, followed by nickel-affinity chromatography for His-tag purification . Limitations include the absence of native glycosylation, which may affect antigenicity compared to mammalian-expressed counterparts .

Research Findings and Therapeutic Implications

  • gp96 Interaction: While HHV-6A entry relies on gp96 binding to glycoprotein Q1 (gQ1), U22’s role in this process remains indirect . Surface gp96 levels correlate with infection efficiency, suggesting U22 may contribute to broader viral entry mechanisms .

  • Immune Evasion: U22’s genetic linkage to U20/U21—proteins that interfere with MHC-I antigen presentation—hints at synergistic immune evasion strategies .

  • Vaccine Development: Recombinant U22’s immunogenicity supports its use in subunit vaccines, though adjuvants like gp96 may enhance efficacy .

Product Specs

Buffer
For liquid formulations, the storage buffer is Tris/PBS-based, containing 5-50% glycerol. Lyophilized powder is prepared using a Tris/PBS-based buffer with 6% Trehalose prior to lyophilization.
Form
Liquid or Lyophilized Powder
Note: We will prioritize shipping the available format. If a specific format is required, please specify this in your order notes; we will fulfill requests to the best of our ability.
Lead Time
3-7 business days
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
U22; EJLF1; Glycoprotein U22
Datasheet & Coa
Please contact us to get it.
Expression Region
21-202aa
Mol. Weight
24.1 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
others
Source
in vitro E.coli expression system
Species
Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Target Names
U22
Target Protein Sequence
SLHIINNENSVFIATHSETELRHWLIFVKMAQRNGTAWWRMASVPINAYFERDIAFLFNPRCVIETAMGSKILCRYNKNIGVVFVDNDTKCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRKERRRFLSRCERFVYYCISVYLFAVVVLCSCWFALDPLFNMWA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Human herpesvirus 6A Glycoprotein U22?

Glycoprotein U22 is a unique transmembrane protein encoded by the Human herpesvirus 6A (HHV-6A), specifically identified in the strain Uganda-1102 (also known as HHV-6 variant A or Human B lymphotropic virus). The protein is derived from the U22 gene, which is part of the U20-U24 gene cluster unique to the Roseolovirus genus within the beta herpesvirus subfamily. The recombinant form typically includes the expression region of amino acids 21-202 with an N-terminal 10xHis tag, resulting in a theoretical molecular weight of approximately 24.1 kDa .

How is Recombinant Human herpesvirus 6A Glycoprotein U22 produced for research applications?

Recombinant HHV-6A Glycoprotein U22 is typically produced using an in vitro E. coli expression system. The protein is expressed with a purification tag (commonly an N-terminal 10xHis tag) to facilitate isolation. The purification process generally involves affinity chromatography followed by quality control assessments, including SDS-PAGE to ensure purity levels exceed 85%. The final product is typically prepared in a Tris/PBS-based buffer with 5-50% glycerol for liquid formulations or with 6% Trehalose (pH 8.0) for lyophilized preparations .

What are the optimal storage and handling conditions for Recombinant U22 protein?

For optimal preservation of Recombinant Human herpesvirus 6A Glycoprotein U22, storage at -20°C is recommended. Repeated freeze/thaw cycles should be strictly avoided as they can lead to protein degradation and loss of functional properties. If the protein is supplied in lyophilized form, reconstitution should be performed according to the manufacturer's protocol, typically using the specified buffer immediately before experimental use. For liquid formulations, the protein is usually provided in a Tris/PBS-based buffer with glycerol as a cryoprotectant, which helps maintain stability during storage .

How can researchers validate the integrity and functionality of Recombinant U22 protein?

A multi-step validation approach is recommended:

  • Purity assessment: Conduct SDS-PAGE analysis to confirm the protein's purity (should exceed 85%) and to verify the expected molecular weight of approximately 24.1 kDa.

  • Western blot verification: Perform immunoblotting using anti-His tag antibodies to confirm the presence of the N-terminal 10xHis tag.

  • Structural integrity: Consider circular dichroism (CD) spectroscopy to assess secondary structure elements.

  • Functional assays: Develop binding assays to evaluate the protein's interaction with potential binding partners, which may include host cell receptors or antibodies.

  • Endotoxin testing: For cell-based applications, confirm that endotoxin levels are within acceptable limits to prevent experimental artifacts .

How does U22 relate to other immunomodulatory proteins in the HHV-6A genome?

While specific functions of U22 in immunomodulation are still being elucidated, research on neighboring genes provides contextual insights. The U20 and U21 proteins, which belong to the same gene cluster as U22, have been identified as viral immunoevasins. U20 targets and suppresses the NKG2D ligand ULBP1, while U21 downregulates ULBP3 and HLA class I molecules. These mechanisms enable HHV-6A to evade recognition by Natural Killer (NK) cells and potentially T cells .

Given that U22 is part of the same gene cluster (U20-U24) unique to Roseoloviruses, it may also contribute to immune evasion strategies, although through potentially different mechanisms. The evolutionary conservation of this gene cluster suggests functional importance in the virus-host interaction, despite being dispensable for basic viral replication .

What experimental approaches are recommended for studying U22's role in viral pathogenesis?

To investigate U22's role in viral pathogenesis, researchers should consider a multi-faceted approach:

  • Gene knockout studies: Generate U22-deficient viral mutants using BAC technology and compare their growth kinetics, cell tropism, and pathogenicity to wild-type viruses in various cell types.

  • Protein interaction studies: Employ techniques such as co-immunoprecipitation, proximity labeling, or yeast two-hybrid screens to identify host or viral proteins that interact with U22.

  • Cellular localization experiments: Use fluorescently tagged U22 constructs for microscopy studies to determine its subcellular localization during infection.

  • Functional immunological assays: Assess the impact of U22 expression on immune cell activation, particularly NK cells and T cells, which are known to be affected by other proteins in the U20-U24 cluster.

  • Transcriptomic and proteomic analyses: Compare cellular responses to wild-type versus U22-deficient viruses to identify pathways potentially modulated by this protein .

What is known about the structure-function relationship of U22 glycoprotein?

  • As a transmembrane protein, U22 likely contains hydrophobic regions that anchor it within cellular membranes.

  • The expression region (amino acids 21-202) used in recombinant constructs likely represents the functional domain of the protein, excluding potential signal peptides or transmembrane regions.

  • Given its classification as a glycoprotein, U22 likely undergoes post-translational modifications in its native state, particularly N-linked or O-linked glycosylation, which may not be present in E. coli-expressed recombinant forms.

Future structural studies using X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy would be valuable to elucidate the three-dimensional structure and potential functional domains of U22 .

What are the potential limitations of using E. coli-expressed recombinant U22 in functional studies?

Using E. coli-expressed recombinant U22 presents several important limitations that researchers should consider:

  • Lack of post-translational modifications: E. coli cannot perform many eukaryotic post-translational modifications, particularly glycosylation, which is likely critical for a glycoprotein like U22. This may significantly affect protein folding, stability, and functionality.

  • Potential misfolding: Transmembrane proteins often fold incorrectly when expressed in prokaryotic systems, potentially leading to non-functional or partially functional recombinant proteins.

  • Solubility issues: Viral membrane proteins may form inclusion bodies in E. coli, requiring denaturing and refolding procedures that can compromise native structure.

  • Endotoxin contamination: E. coli-derived proteins may contain endotoxins that can interfere with immunological assays if not properly removed.

  • His-tag interference: The N-terminal 10xHis tag, while useful for purification, might interfere with protein function, particularly if the N-terminus is involved in protein-protein interactions or receptor binding .

How can researchers reconcile the dispensability of U22 for in vitro growth with its potential importance in vivo?

The apparent contradiction between U22 being dispensable for viral growth in vitro yet conserved in natural isolates can be addressed through several research approaches:

  • Ex vivo infection models: Compare the behavior of wild-type and U22-deficient viruses in more complex ex vivo human tissue systems that better recapitulate the in vivo environment.

  • Immune component integration: Introduce specific immune components (such as NK cells or T cells) to in vitro culture systems to determine if U22 becomes important under immune pressure.

  • Animal models: Where applicable, utilize humanized mouse models to assess if U22 contributes to viral persistence, tissue tropism, or immune evasion in vivo.

  • Temporal expression analysis: Examine if U22 expression is regulated temporally during infection, potentially indicating stage-specific functions not apparent in standard growth curves.

  • Co-infection studies: Investigate if U22 provides advantages during co-infection with other pathogens or under specific stress conditions .

What emerging technologies could advance our understanding of U22's role in HHV-6A biology?

Several cutting-edge technologies hold promise for elucidating U22's biological significance:

  • CRISPR-Cas9 genome editing: Generate more precise viral and cellular knockouts to study U22 function in various contexts.

  • Single-cell technologies: Apply single-cell RNA-seq and proteomics to understand heterogeneity in cellular responses to U22 expression.

  • Organoid models: Utilize three-dimensional tissue organoids to study U22's role in a more physiologically relevant context.

  • Cryo-electron microscopy: Determine the high-resolution structure of U22 and its potential complexes with host factors.

  • Interactome mapping: Apply techniques like BioID or APEX proximity labeling to comprehensively map U22's protein interaction network within infected cells.

  • Systems biology approaches: Integrate multi-omics data to position U22 within the broader context of viral pathogenesis and host response networks .

How might comparative analysis of U22 across different HHV-6 strains inform our understanding of its function?

Comparative analysis of U22 across different HHV-6 strains (particularly between HHV-6A and HHV-6B) could provide valuable insights:

  • Sequence conservation analysis: Identify highly conserved regions that may represent functional domains under evolutionary pressure.

  • Variant-specific differences: Determine if sequence variations between HHV-6A and HHV-6B U22 correlate with differences in cell tropism, pathogenicity, or immune evasion strategies.

  • Recombination studies: Create chimeric viruses expressing U22 from different strains to map functional domains.

  • Evolutionary analysis: Conduct phylogenetic studies to trace the evolutionary history of U22 in relation to other viral proteins and host factors.

  • Clinical isolate sequencing: Analyze U22 sequences from clinical isolates to identify potential correlations between sequence variations and disease manifestations or severity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.