Recombinant Human herpesvirus 6A Glycoprotein U23 (U23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
U23; EqLF1; Glycoprotein U23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-236
Protein Length
Full Length of Mature Protein
Species
Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Target Names
U23
Target Protein Sequence
LNLMTTEVSATEFASIASKNMETDVSTSSDYLTGKSETTFSANSETWGKNVTEISIDSET YLNQSFMVTSTLAVETTDRSIGNNVNVTSSFPTVKGDETQNIETSFTVISASTFSDVSEK TPQGLSTKSTPKKTVQALWETDTVQVLEFTDTHEGDEEYFKDFLSSLVIWIGGISFIGAF VILIVILCNWYKKDKQRSLFWDEEKKPDVQMRRDVKTCR
Uniprot No.

Target Background

Gene References Into Functions
  1. U23 protein, expressed as a glycoprotein in the late stages of infection, was not incorporated into virions. PMID: 24503071
Database Links

KEGG: vg:1487989

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the biological role of HHV-6A Glycoprotein U23 in viral pathogenesis?

Glycoprotein U23 is expressed at the late phase of HHV-6A infection as a glycoprotein but is not incorporated into virions. Research has demonstrated that U23 primarily localizes to the trans-Golgi network (TGN) in HHV-6A-infected cells, suggesting a role in viral assembly or cellular manipulation rather than direct virion structure . Notably, experimental analysis using U23-defective mutant viruses revealed that the gene is nonessential for viral replication in vitro . This finding indicates that while U23 may contribute to infection dynamics in vivo, it is not required for the basic replication cycle under laboratory conditions. Researchers should note that this non-essential characteristic distinguishes U23 from many other viral glycoproteins that typically play critical roles in viral entry or assembly.

Despite being nonessential for in vitro replication, U23 represents one of seven unique genes (U20, U21, U23, U24, U24A, U26, and U100) encoded by members of the Roseolovirus genus within the betaherpesvirus subfamily . This conservation across related viruses suggests possible species-specific or immune evasion functions that may not be apparent in simplified cell culture systems.

What expression systems are most effective for producing recombinant HHV-6A Glycoprotein U23?

Recombinant HHV-6A Glycoprotein U23 can be successfully expressed using prokaryotic expression systems. E. coli has been demonstrated as an effective host for expressing the 18-236 amino acid fragment of U23 from the HHV-6A Uganda-1102 strain . Both His-tagged and tag-free versions of the protein can be generated, allowing flexibility for downstream applications that may be affected by tag presence.

For purification methodology, standard affinity chromatography protocols for His-tagged proteins are applicable, typically achieving >90% purity as determined by SDS-PAGE analysis . For functional studies, it's important to note that the biological activity of recombinant U23 can be determined by its binding ability in functional ELISA assays . The properly expressed and purified recombinant protein is suitable for multiple research applications including ELISA, Western blotting, and immunoprecipitation studies .

For storage and stability, the recombinant protein maintains optimal activity when stored in Tris-based buffer with 50% glycerol at -20°C, with extended storage recommended at -80°C . Researchers should avoid repeated freeze-thaw cycles, with working aliquots maintained at 4°C for up to one week to preserve functionality .

How can researchers effectively determine the subcellular localization of U23 during infection?

Determining the subcellular localization of U23 requires a systematic approach combining multiple complementary techniques. Research has established that U23 primarily localizes to the trans-Golgi network (TGN) in HHV-6A-infected cells . To replicate and extend these findings, researchers should implement:

  • Immunofluorescence microscopy with co-localization markers: Using antibodies specifically targeting U23 in conjunction with established markers for subcellular compartments, particularly TGN-specific proteins like TGN46 or syntaxin 6. Confocal microscopy with z-stack acquisition is recommended for precise spatial resolution.

  • Subcellular fractionation followed by Western blotting: This complementary biochemical approach involves separating cellular compartments through differential centrifugation, followed by immunoblotting of fractions with U23-specific antibodies alongside control markers for various organelles.

  • Electron microscopy with immunogold labeling: For highest resolution analysis, transmission electron microscopy with immunogold-labeled antibodies against U23 can precisely locate the protein within cellular ultrastructure.

For temporal studies tracking U23 localization throughout the viral replication cycle, researchers should harvest infected cells at multiple timepoints post-infection, designating early (6-24h), intermediate (24-48h), and late (48-72h) phases based on established HHV-6A replication kinetics .

What sequence conservation exists for U23 among different Roseolovirus members?

Comparative sequence analysis reveals interesting patterns of conservation for U23 among Roseoloviruses. U23 demonstrates exceptionally high conservation between HHV-6A and HHV-6B variants, with 94.6% amino acid similarity and 94.1% amino acid identity . This near-identical sequence suggests strong selective pressure to maintain U23 structure and function between these closely related variants.

  • Rapid evolutionary diversification of U23 between viral species

  • Different functional constraints on U23 between HHV-6 and HHV-7

  • Potentially different roles of U23 in the respective viral life cycles

The conservation pattern is visualized in the following table extracted from research data:

FunctionRoseolovirus ORF%S with HHV-6A% I with HHV-6A%S with HHV-7%I with HHV-7
GlycoproteinU2394.694.126.920.9

This divergence pattern contrasts with other Roseolovirus-specific genes like U15EX3, which maintains 82% similarity between HHV-6A and HHV-7 . The selective conservation of U23 between HHV-6 variants but not with HHV-7 suggests that researchers should consider variant-specific functions when designing experiments.

What methodologies are available for functional characterization of U23 in the viral lifecycle?

Several complementary methodologies can be employed to characterize U23 function within the HHV-6A lifecycle:

  • Generation of U23-defective viral mutants: The primary approach demonstrated in published research involved creating U23-defective mutant viruses to assess the gene's role in viral replication . This can be accomplished using bacterial artificial chromosome (BAC) systems, which allow precise genetic manipulation of the viral genome similar to methods used for other HHV-6A genes .

  • Growth kinetics and viral load assessment: Comparing growth curves between wild-type and U23-defective viruses through quantitative PCR or TCID50 assays provides insights into replication efficiency impacts.

  • Trans-complementation assays: Providing U23 in trans to U23-defective viruses can confirm phenotype specificity and rescue functional aspects. This typically involves creating stable cell lines expressing U23 or transient transfection approaches.

  • Cell fusion assays: While not directly tested for U23, cell-cell fusion assays have been established for HHV-6A using other glycoproteins . These systems quantitatively measure fusion between effector cells expressing viral glycoproteins and target cells expressing appropriate receptors through reporter gene activation. This methodology could be adapted to test potential U23 contributions to membrane fusion events.

  • Protein-protein interaction studies: Co-immunoprecipitation, proximity ligation assays, or yeast two-hybrid screens can identify viral or cellular binding partners of U23, providing functional insights.

Researchers should note that while U23 is nonessential for in vitro replication, it may have important roles in immune evasion, tissue tropism, or pathogenesis that are only evident in more complex experimental systems or in vivo models.

What post-translational modifications occur on U23 and how can they be characterized?

HHV-6A U23 undergoes glycosylation as a key post-translational modification (PTM), which likely impacts its folding, stability, and potential interactions . To comprehensively characterize these modifications, researchers should implement:

  • Glycosylation site prediction and analysis: Computational tools can identify potential N-linked (Asn-X-Ser/Thr) and O-linked glycosylation sites in the U23 sequence as starting points for experimental validation.

  • Enzymatic deglycosylation assays: Treatment with enzymes like PNGase F (for N-linked glycans) or O-glycosidase (for O-linked glycans) followed by mobility shift analysis on Western blots can confirm glycosylation and distinguish glycan types.

  • Site-directed mutagenesis: Mutating predicted glycosylation sites followed by expression analysis can determine which sites are utilized and their functional importance.

  • Mass spectrometry: For comprehensive glycan profiling, liquid chromatography-mass spectrometry (LC-MS/MS) analysis of purified U23 can identify specific glycan structures and their attachment sites.

  • Lectin binding assays: Using different lectins with specificities for particular glycan structures can provide insights into the types of sugars present on U23.

Since U23 localizes to the trans-Golgi network , researchers should particularly focus on mature glycosylation patterns characteristic of proteins processed through this compartment. Comparing glycosylation patterns between recombinant U23 expressed in different systems (bacterial vs. mammalian) and native viral U23 will be essential to ensure that studies with recombinant protein reflect physiologically relevant modifications.

How can researchers efficiently generate and validate U23-defective mutant viruses?

The generation of U23-defective mutant viruses requires precise genetic engineering approaches. Based on methodologies described for similar studies with HHV-6A genes, researchers should follow this protocol:

This systematic approach ensures that observed phenotypes can be confidently attributed to the specific U23 mutation rather than other genetic alterations or experimental artifacts.

What cell culture systems are optimal for studying U23 functionality?

The selection of appropriate cell culture systems is critical for meaningful U23 research. Based on established HHV-6A research methodologies, the following systems are recommended:

  • JJhan cells: This T-cell line has been successfully used for HHV-6A BAC transfection and initial virus reconstitution . When transfected with HHV-6A BAC DNA, these cells support the initial stages of viral replication and can be used to generate infectious virus.

  • Umbilical cord blood mononuclear cells (CBMCs): These primary cells are highly permissive for HHV-6A replication and should be co-cultured with transfected JJhan cells to amplify reconstituted virus . CBMCs provide a physiologically relevant environment for assessing U23 function in the context of productive infection.

  • 293T cells: While not directly permissive for complete HHV-6A replication, this cell line has been utilized in glycoprotein functional studies, particularly for cell-cell fusion assays examining viral entry mechanisms . These cells can be effectively transfected with U23 expression constructs to study specific aspects of U23 function in isolation from other viral components.

For advanced functional studies, researchers should consider:

  • Dual-reporter systems: Implementing luciferase-based reporter systems similar to those used for other HHV-6A glycoproteins can provide quantitative measurements of U23-mediated effects .

  • Inducible expression systems: Tetracycline-regulated expression of U23 allows controlled timing and expression levels for temporal studies.

  • Fluorescently tagged U23: Creating fusion proteins with fluorescent markers enables real-time imaging of U23 trafficking and localization, though care must be taken to ensure tag addition doesn't interfere with protein function.

When establishing these systems, it's essential to confirm that U23 expression levels and post-translational modifications reflect those observed during authentic viral infection.

What experimental approaches can determine potential interactions between U23 and other viral or cellular proteins?

While specific U23 interaction partners haven't been definitively established in the literature, researchers can apply these methodological approaches to identify and characterize potential interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against U23 to pull down protein complexes from infected cells, followed by mass spectrometry to identify interacting partners. Both forward and reverse Co-IP should be performed for validation.

  • Proximity-based labeling: Techniques such as BioID or APEX2, where U23 is fused to a promiscuous biotin ligase that biotinylates proximal proteins, can identify the U23 interaction neighborhood within cells.

  • Yeast two-hybrid screening: Although challenging for membrane proteins like U23, modified split-ubiquitin yeast two-hybrid systems designed for membrane proteins can screen for binary interactions against cDNA libraries.

  • Bimolecular Fluorescence Complementation (BiFC): By fusing complementary fragments of fluorescent proteins to U23 and candidate partners, interaction can be visualized as reconstituted fluorescence when proteins come into proximity.

  • Protein fragment complementation assays: Similar to BiFC but using complementary fragments of enzymes like luciferase to provide quantitative readout of protein-protein interactions.

  • Cross-linking mass spectrometry: Chemical cross-linking of proteins in native environments followed by mass spectrometry can capture transient interactions and provide structural information about interaction interfaces.

Given that U23 localizes to the trans-Golgi network , interactions with Golgi trafficking machinery would be particularly interesting to investigate. Additionally, since other HHV-6A glycoproteins like gH, gL, gQ1, and gQ2 form functional complexes , researchers should examine whether U23 participates in similar multiprotein assemblies despite not being incorporated into virions.

What structural analysis techniques are applicable to characterizing U23?

Structural characterization of membrane glycoproteins like U23 presents significant technical challenges but offers crucial insights into function. Researchers should consider these methodological approaches:

For glycoprotein U23, special attention should be paid to the impact of glycosylation on structure. Comparing structures of glycosylated versus deglycosylated forms can reveal how these modifications affect protein folding and stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.