Recombinant Human herpesvirus 6A Uncharacterized protein U15 (U15)

Shipped with Ice Packs
In Stock

Description

Functional Insights

While U15 remains largely uncharacterized, genomic and transcriptomic studies provide context:

  • Transcriptional activity: U15 is transcribed as part of a complex splicing network involving adjacent ORFs U16 and U17 in HHV-6A . Northern blot analyses reveal low-abundance transcripts (1.5–3.9 kb) during lytic infection .

  • Evolutionary conservation: Shares 100% amino acid identity with HHV-6A(GS) strain ORF C , but differs from HHV-6B U15 (191 aa) , suggesting variant-specific roles.

  • Potential immune modulation: HHV-6A infection upregulates HLA-G isoforms in endothelial cells , though U15’s direct involvement remains unconfirmed.

Research Applications

This recombinant protein is primarily utilized for:

  • Antibody production: Serves as an immunogen due to its viral origin and purity .

  • Structural studies: Facilitates crystallization trials for unresolved HHV-6A protein architectures .

  • Functional assays: Investigates interactions with host proteins, given HHV-6’s known immune evasion strategies .

Technical Data

Expression and purification:

ParameterDetail
Expression systemE. coli
FormLyophilized powder
Storage bufferTris/PBS-based buffer, 6% Trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

Stability:

  • Stable at -80°C for long-term storage; avoid freeze-thaw cycles .

Comparative Analysis with HHV-6B U15

FeatureHHV-6A U15HHV-6B U15
Amino acid length110 aa191 aa
UniProt IDQ69550P52599
Commercial availabilityRFL34353HF (Creative BioMart)RFL15949HF (Creative BioMart)

Research Limitations

  • No direct functional data for U15 exists in current literature; its role in viral replication or immune modulation remains speculative .

  • Interactions with host proteins are undocumented, unlike HHV-6B tegument protein pU11, which binds capsid triplexes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your desired format in the order notes, and we will strive to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference for your own protocols.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
In general, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize fulfilling your request during the production process.
Synonyms
U15; EFLF3; Uncharacterized protein U15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Target Names
U15
Target Protein Sequence
MDVWKRQRLQECRELCPLPVLMSLSNMFSKIEIVYVKYLFKMDFSTMYRYILPALTLSMT VTKSLVIEMLFILKRWEDIDQFFRLNIRKVNDCFIVAQFNHIPIKRWVLI
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does U15 from HHV-6A differ from its counterpart in HHV-6B?

While both HHV-6A and HHV-6B encode U15 proteins, they differ in length and sequence. HHV-6A U15 consists of 110 amino acids, while HHV-6B U15 is 191 amino acids in length . This difference may contribute to the distinct biological properties and pathogenesis associated with HHV-6A versus HHV-6B infections. HHV-6A has been more frequently associated with neuroinflammatory diseases such as multiple sclerosis, while HHV-6B is the causative agent of exanthem subitum (roseola infantum) .

What is currently known about the expression pattern of U15 during viral infection?

U15 expression occurs as part of a complex transcriptional program. Research indicates that U15 can be expressed as part of a spliced transcript that includes U16 . Single-stranded U16 and U17 gene-specific RNA probes hybridized with at least five RNA species from infected cells, demonstrating that the expression of these transcripts, including those containing U15, is differentially regulated . While some transcripts from this region are expressed as immediate-early gene products, others appear to be late gene products .

What are the recommended methods for expressing and purifying recombinant HHV-6A U15 protein?

For recombinant expression of HHV-6A U15, E. coli-based expression systems with His-tag purification approaches have been successfully employed . The methodology typically involves:

  • Cloning the U15 ORF into a bacterial expression vector with an N-terminal or C-terminal His-tag

  • Transforming E. coli strains optimized for protein expression

  • Inducing protein expression with IPTG

  • Lysing cells and purifying using nickel affinity chromatography

  • Confirming protein identity by Western blot analysis with anti-His antibodies or U15-specific antibodies

Protein solubility may be improved by optimizing expression conditions, including temperature reduction during induction (16-20°C) and the use of solubility-enhancing fusion tags.

What cell culture systems are most appropriate for studying HHV-6A U15 function?

Based on research with HHV-6A, several cell lines have proven useful for studying viral genes, including U15:

Cell LineOriginCharacteristicsUtility for HHV-6A Studies
SupT1CD4+ human T cellsSupports productive HHV-6A infectionGood for viral replication studies
HSB-2T-cell leukemiaHighly permissive for HHV-6AIdeal for viral propagation and protein expression studies
U2OSOsteosarcomaSupports viral genome integrationUseful for studying viral latency and integration
293TEmbryonic kidneyTransfectable, supports viral BAC maintenanceGood for recombinant protein expression

For studying U15 specifically, systems allowing controlled expression (such as inducible promoters) in relevant cell types would be most informative .

How can researchers effectively detect U15 expression in experimental systems?

Detection of U15 expression can be challenging due to its relatively small size and potentially low expression levels. Recommended approaches include:

  • RT-PCR/qPCR: Using primers specific to U15 or spanning the U16-U15 junction for detecting spliced transcripts

  • 5' RACE: For identifying transcription start sites and alternative splicing events involving U15

  • RNA-Seq: For comprehensive transcriptome analysis during infection

  • Western blotting: Using antibodies against recombinant U15 or tags on recombinant constructs

  • Immunofluorescence: For cellular localization studies with tagged constructs

When studying U15 expression during viral infection, consider using phosphonoacetic acid to inhibit viral DNA replication, which can help distinguish immediate-early from late gene expression patterns .

What is the potential role of U15 in viral transactivation and genomic integration?

While the specific function of U15 remains uncharacterized, its location within the IE-B region suggests potential involvement in viral gene regulation. The IE-B region contains genes implicated in HIV LTR transactivation . Studies have shown that HHV-6A can integrate into host telomeres, establishing chromosomally integrated HHV-6A (ciHHV-6A) . Investigation of U15's potential role in this process could focus on:

  • Analyzing U15 expression during different stages of viral integration

  • Creating U15 knockout or mutant viruses using BAC technologies

  • Examining U15 interaction with telomeric proteins

  • Comparing U15 sequence and expression between integrated and non-integrated viral genomes

This work would benefit from cell culture systems that reliably support HHV-6A integration, such as U2OS cells, which have been demonstrated to facilitate maintenance of ciHHV-6A genomes .

How might U15 contribute to HHV-6A pathogenesis and associated diseases?

HHV-6A has been associated with various conditions, including neuroinflammatory diseases like multiple sclerosis . To investigate U15's potential role in pathogenesis:

  • Analyze U15 expression in patient samples with active HHV-6A infection

  • Examine potential immunomodulatory effects of U15 on host cells

  • Investigate interactions between U15 and components of host immune signaling pathways

  • Study U15 expression during viral reactivation from latency

Given that HHV-6A infection promotes glucose metabolism in infected T cells by activating AKT-mTORC1 signaling , researchers might investigate whether U15 contributes to this metabolic reprogramming, potentially using glycolytic inhibitors like 2-DG or mTORC1 inhibitors like rapamycin in U15 expression studies.

How does viral sncRNA expression correlate with U15 expression during viral activation?

Recent research has identified an early stage of HHV-6A activation called "transactivation," marked by transcription of viral small non-coding RNAs (sncRNAs) . Investigating the relationship between U15 expression and viral sncRNAs could provide insights into the virus activation process:

  • Perform temporal expression analyses comparing U15 mRNA levels with sncRNA expression

  • Determine whether U15 protein regulates sncRNA expression or processing

  • Investigate whether sncRNAs affect U15 expression or function

  • Analyze U15 expression in clinical specimens positive for HHV-6A sncRNAs

This research direction is particularly relevant as sncRNAs like U14 have been identified as potential biomarkers for HHV-6 activation in clinical conditions .

What viral and cellular proteins might interact with HHV-6A U15?

Though specific U15 interactions have not been extensively characterized, researchers could investigate potential binding partners based on related herpesvirus proteins:

  • Viral proteins: Other proteins encoded in the IE-B region, particularly U16 and U17, given their co-expression in spliced transcripts

  • Host transcription factors: Given the location in the IE-B region, U15 might interact with host transcriptional machinery

  • Splicing factors: As U15 is part of differentially spliced transcripts, it might interact with or regulate components of the splicing machinery

  • Heat shock proteins: Recent research has shown that HHV-6A U37 interacts with heat shock proteins and activates the heat shock response . Similar approaches could be used to investigate U15 interactions

Techniques for studying these interactions include co-immunoprecipitation, yeast two-hybrid screening, proximity labeling, and mass spectrometry-based interactome analyses.

How does U15 fit into the transcriptional and functional framework of HHV-6A gene expression?

U15 exists within a complex transcriptional framework in the IE-B region. Research has identified at least two transcription initiation sites used to express transcripts encoding U17 and U16 gene products . The U17/U16 spliced gene products are expressed at immediate-early times after infection, while a multiply spliced gene product encoded by U16 is expressed as a late gene .

To better understand U15's role in this framework:

  • Use temporal transcriptome analyses to map U15-containing transcripts throughout the viral lifecycle

  • Employ reporter gene assays to identify regulatory elements controlling U15 expression

  • Investigate the effects of U15 overexpression or knockdown on viral gene expression patterns

  • Compare U15 expression between productive infection and latency models

Understanding this framework is critical as the IE-B region has been implicated in viral transactivation, including activation of the HIV LTR .

What approaches can be used to study U15 function in the context of full viral replication?

Studying U15 in the context of complete viral replication requires sophisticated molecular virology techniques:

  • BAC-based mutagenesis: Using bacterial artificial chromosome (BAC) systems containing the complete HHV-6A genome to create U15 mutants

  • Complementation systems: Providing U15 in trans to rescue potential growth defects in U15-mutant viruses

  • Conditional expression systems: Creating viruses with regulatable U15 expression

  • Single-cell analysis: Examining the effects of U15 expression variability on viral replication outcomes

The recent development of HHV-6A BAC systems has made these approaches more feasible . These systems allow for introduction of the 160-kb HHV-6A genome into BACs and stable maintenance in selected cells. The HHV-6A-BAC vectors have been shown to express early and late genes in appropriate cell types, providing a platform for U15 functional studies .

What are the most promising approaches for determining the structural properties of U15?

Understanding the structure of U15 would provide significant insights into its function. Researchers might consider:

  • X-ray crystallography of purified recombinant U15 protein

  • NMR spectroscopy for solution structure determination, particularly suitable for smaller proteins like U15

  • Cryo-electron microscopy if U15 forms part of larger complexes

  • Computational structural prediction using the latest AI-based tools, which have shown increasing accuracy for protein structure prediction

These structural studies could be complemented by site-directed mutagenesis to identify functionally important residues and domains within the U15 protein.

How might U15 contribute to viral immune evasion strategies?

As a betaherpesvirus protein, U15 might play a role in immune evasion. Researchers could investigate:

  • The effect of U15 expression on interferon signaling pathways

  • Whether U15 modulates antigen presentation in infected cells

  • Potential interactions between U15 and components of innate immune signaling

  • The impact of U15 on inflammatory cytokine production in infected cells

The relationship between U15 and mitochondrial function may be particularly interesting to explore, given that HHV-6A transactivation has been associated with alterations in mitochondria-associated pathways and increased mitochondrial fragmentation .

What is the potential of U15 as a target for antiviral development or as a biomarker for HHV-6A infection?

The development of U15-focused diagnostic and therapeutic approaches could include:

  • Diagnostic applications: Developing antibodies or PCR assays specifically targeting U15 or U15-containing transcripts to distinguish HHV-6A from HHV-6B infections

  • Therapeutic targeting: If U15 proves essential for viral replication or pathogenesis, small molecule inhibitors or peptide-based approaches could be developed

  • Vaccine development: Including U15 epitopes in subunit vaccine formulations if antibodies against U15 show neutralizing potential

  • Biomarker potential: Investigating whether detection of U15 transcripts correlates with specific disease states or viral activation stages

This research would complement recent work on viral sncRNAs as biomarkers for HHV-6 activation and investigations into metabolic inhibitors that affect HHV-6A replication .

What are common challenges in expressing and working with recombinant HHV-6A U15 protein, and how can they be addressed?

Researchers working with recombinant U15 may encounter several technical challenges:

  • Protein solubility issues:

    • Try different expression temperatures (16-25°C)

    • Use solubility-enhancing fusion tags (MBP, SUMO)

    • Optimize buffer conditions with various detergents or additives

  • Low expression levels:

    • Test different E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Optimize codon usage for bacterial expression

    • Consider eukaryotic expression systems for proper folding

  • Protein stability problems:

    • Include protease inhibitors throughout purification

    • Identify optimal storage conditions (glycerol percentage, temperature)

    • Consider flash-freezing aliquots to prevent freeze-thaw degradation

  • Activity assessment difficulties:

    • Develop functional assays based on predicted activities

    • Ensure proper folding through circular dichroism analysis

    • Consider co-expression with interacting partners

How can researchers troubleshoot issues when studying U15 in the context of viral infection?

When studying U15 during HHV-6A infection, several challenges may arise:

  • Detection difficulties:

    • Use highly sensitive RT-PCR methods for transcript detection

    • Consider epitope tagging U15 in recombinant viruses

    • Develop high-affinity antibodies against U15

  • Distinguishing U15-specific effects:

    • Create U15 knockout or mutant viruses using BAC technology

    • Use complementation assays to confirm phenotypes

    • Employ inducible expression systems to control timing of U15 expression

  • Cell culture limitations:

    • Select appropriate cell lines that support HHV-6A infection (SupT1, HSB-2)

    • Consider primary cell models for physiological relevance

    • Use mixed culture systems to study cell-to-cell transmission

  • Temporal expression challenges:

    • Synchronize infections to improve signal-to-noise ratio

    • Use viral DNA polymerase inhibitors to distinguish immediate-early from late gene expression

    • Employ single-cell approaches to account for asynchronous infection

These troubleshooting approaches will aid researchers in overcoming technical hurdles while studying this challenging but potentially important viral protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.