Recombinant Human herpesvirus 6A Virion egress protein U34 (U34)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Herpesvirus 6A Virion Egress Protein U34 (U34)

Recombinant Human herpesvirus 6A Virion egress protein U34 (U34) is a protein that plays a crucial role in the nuclear egress of virions, which is the initial phase of viral release from infected cells . U34 is a protein encoded by the Human herpesvirus 6A (HHV-6A) . HHV-6A is a double-stranded DNA virus that belongs to the Roseolovirus genus, within the Betaherpesvirinae subfamily .

Function of U34

U34, also known as primary envelopment factor U34, is essential for the egress of virions from the nucleus . It interacts with U37 in the nuclear egress complex (NEC) . The NEC is a structure formed through intermolecular interactions, creating a hexagonal lattice, and U34's interaction with U37 is vital for its formation and function .

U34's Role in Intracellular Signaling

U34 influences intracellular signaling pathways, similar to UL31 homologs in Herpes Simplex Virus 1 and 2 (HSV-1 and HSV-2) . When co-expressed with U37, U34 causes U37 to relocalize to the nuclear rim. U34 itself, which is typically found in cytoplasmic membranous structures, also moves to the nuclear rim in the presence of U37 .

Interaction with U37 and the Heat Shock Response

While U37 can stimulate the heat shock element (HSE) promoter, this stimulation does not occur when U37 is co-expressed with U34, suggesting that the formation of the NEC may mask the element in U37 responsible for HSE stimulation .

Impact of U34 on Heat Shock Protein Expression

In cells infected with HHV-6A, heat shock proteins (HSPs) are upregulated, and inhibiting HSF1 or HSPs can impair viral replication, indicating the importance of molecular chaperones during HHV-6A infection .

U34 and tRNA Modification

U34 is also associated with tRNA modification, specifically the thiolation of uridine at position 34 (U34) in tRNA molecules . The wobble uridine at position 34 (U34) in tRNAs is a frequent target for chemical modification, and the loss of U34-enzymes can lead to increased protein aggregation .

  • Thiolation of U34 Thiolation of U34 in tRNA enhances the binding of cognate tRNAs to the ribosomal A-site, which promotes efficient protein translation .

  • U34-Codon Enrichment Genes enriched in U34-codons are linked to biological pathways related to the cell cycle and specific protein families like kinesins .

  • Impact on Protein Expression Depletion of enzymes responsible for U34 modification can result in decreased protein expression levels .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NEC2; U34; XILF2; Nuclear egress protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Target Names
NEC2
Target Protein Sequence
MANVLKEKMYDELLSATCRILKLGSHDYRITERNLLSKNPKFPLCDIILKLDYAYNLEYL LSLWEHVTKQEPRFVFKNTGGAVSMSCYLHAPVKVEGHHAVRECNILRVNECLTVRMSDI VAMKPSTFAVFTKCIIRRNRDDTYVVEFVAFGPENESEYISLLKAIFLKKCSMGKQHLES NRFCQGLRRRSSHVLEKGRFESSGKVVNKASAVVTSQESIKQFYEKEKSLLSGVKFWRLS ERHCRFALVGICFLLALYFCYVLLKKTPTPASGSVV
Uniprot No.

Target Background

Function

Recombinant Human herpesvirus 6A Virion egress protein U34 (U34) plays a crucial role in virion nuclear egress, the initial step of virion release from infected cells. Within the host nucleus, U34 interacts with the newly formed capsid via its vertices, directing it to the inner nuclear membrane through its association with NEC2. U34 induces capsid budding at the inner nuclear membrane and its subsequent envelopment within the perinuclear space. The U34/NEC2 complex facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm, where it proceeds to secondary budding sites in the Golgi or trans-Golgi network.

Database Links

KEGG: vg:1487911

Protein Families
Herpesviridae NEC2 protein family
Subcellular Location
Host nucleus inner membrane; Single-pass membrane protein.

Q&A

What is HHV-6A U34 and what is its role in viral replication?

HHV-6A U34 is a virion egress protein that serves as a homolog of HSV UL34 and HCMV UL50 . Like other herpesvirus nuclear egress complex (NEC) proteins, U34 plays a crucial role in facilitating the exit of viral nucleocapsids from the nucleus during the viral replication cycle. The protein is typically detected in cytoplasmic membranous structures when expressed alone but undergoes dynamic relocalization to the nuclear rim when co-expressed with U37 .

How does U34 interact with other viral proteins, particularly U37?

The interaction between U34 and U37 is critical for proper function of both proteins. When co-expressed, U34-Strep and Flag-HHV-6A U37 show mutual influence on their localization, with both proteins relocalizing to the nuclear rim . This interaction likely forms the nuclear egress complex (NEC) similar to that observed in other herpesviruses. Research indicates that when expressed separately, U34-Strep is detected in cytoplasmic membranous structures, but in the presence of Flag-HHV-6A U37, it relocates to the nuclear rim .

What experimental methods are commonly used to study U34 expression and localization?

Researchers typically use immunoblotting and fluorescence assays to detect the expression and localization of U34 . Tagged versions of the protein (such as U34-Strep) are often employed to facilitate detection. Co-expression plasmids encoding both U34 and U37 separated by P2A self-cleaving peptides have been used to ensure the expression of both proteins in the same cell for interaction studies .

How does the U34-U37 interaction contribute to the structure and function of the nuclear egress complex?

Structural analysis of nuclear egress complexes (NECs) from other herpesviruses like HSV-1, EBV, and HCMV has revealed that they form hexagonal lattice structures through inter-molecular interactions . The U34-U37 interaction in HHV-6A likely contributes to a similar structural arrangement. This hexagonal lattice at the nuclear membrane is essential for the budding and egress of viral particles. The precise molecular mechanisms by which this complex facilitates membrane deformation and scission during nuclear egress remain an active area of investigation.

How does U34 contribute to HHV-6A latency and reactivation?

HHV-6A can achieve latency through chromosomal integration, specifically into telomeres . While the direct role of U34 in this process is not explicitly described in the available literature, nuclear egress proteins are critical for the production of infectious virions during reactivation. The reactivation of integrated HHV-6A has been demonstrated using compounds like trichostatin A (TSA) and 12-O-tetradecanoyl-13 acetate (TPA), which are known to reactivate latent herpesviruses . Understanding how U34 functions during these reactivation events could provide insights into viral persistence and pathogenesis.

What is the relationship between U34 function and HSF1/heat shock response during HHV-6A infection?

While U34 itself has not been directly linked to the heat shock response, its partner protein U37 has been shown to activate the heat shock element (HSE) promoter and lead to the accumulation of heat shock proteins . This activation is dependent on heat shock transcriptional factor 1 (HSF1), which becomes phosphorylated in the presence of U37 . Interestingly, the expression of U37 did not stimulate HSE-luc in the presence of U34-Strep, suggesting that the formation of the NEC might mask elements in U37 responsible for HSE stimulation . This interaction represents a potential regulatory mechanism for viral protein function during infection.

What are effective strategies for expressing and purifying recombinant U34 for structural studies?

For structural and functional studies of U34, researchers have successfully used expression systems in mammalian cells, particularly HEK293T cells, with affinity tags such as Strep-tag for purification . When designing expression constructs, it's important to consider that U34 is typically membrane-associated and may require specialized extraction methods. Co-expression with U37 may affect the localization and solubility properties of U34, which should be taken into account when developing purification protocols.

How can researchers effectively analyze the dynamics of U34-U37 interactions?

Several approaches can be used to study U34-U37 interactions:

  • Co-immunoprecipitation assays using tagged versions of both proteins

  • Fluorescence microscopy to visualize colocalization at the nuclear rim

  • Fluorescence resonance energy transfer (FRET) to detect direct protein-protein interactions

  • Mutational analysis to identify critical residues for interaction

The study described in the search results utilized expression plasmids for Flag-HHV-6A U37 and HHV-6A U34-Strep, with immunoblotting and fluorescence assays to analyze their expression and localization .

What approaches are useful for studying the role of U34 in viral genome integration and reactivation?

Studying U34's potential role in HHV-6A genome integration and reactivation could involve:

  • Chromatin immunoprecipitation (ChIP) to detect potential association with telomeric regions

  • Analysis of U34 expression patterns during latency establishment and reactivation

  • CRISPR/Cas9-mediated mutation of U34 to assess effects on integration efficiency

  • Reactivation studies using compounds like TSA and TPA in cells with integrated viral genomes

Research has shown that HHV-6A can efficiently integrate into telomeres during latency rather than forming episomes, and the integrated viral genome is capable of producing virions upon reactivation .

How should researchers interpret changes in U34 localization during viral infection?

Changes in U34 localization, such as relocalization to the nuclear rim in the presence of U37, should be interpreted in the context of nuclear egress complex formation. Quantitative image analysis can be used to measure the extent of colocalization with nuclear membrane markers and with U37. Time-course studies can provide insights into the dynamics of U34 localization during different stages of viral infection. The observation that U34-Strep relocates to the nuclear rim in the presence of Flag-HHV-6A U37 suggests that proper complex formation is critical for the functional localization of both proteins .

What are the implications of U34 mutations for viral fitness and pathogenesis?

Mutations in U34 that disrupt its interaction with U37 or its localization to the nuclear membrane would likely impair viral egress and reduce viral fitness. The specific implications for pathogenesis would depend on the nature of the mutations and their effects on protein function. Since proper viral egress is essential for cell-to-cell spread, mutations that compromise this process could attenuate viral dissemination within the host. Comparative studies of U34 sequences from different clinical isolates could provide insights into natural variation and its potential relationship to virulence.

How can researchers distinguish between the roles of U34 in different HHV-6A life cycle stages?

To differentiate between the roles of U34 in different stages of the viral life cycle, researchers can:

  • Use time-course studies to monitor U34 expression and localization during infection

  • Employ conditional expression systems to modulate U34 levels at specific stages

  • Utilize inhibitors that target specific viral processes to isolate the effects of U34 in different contexts

  • Compare U34 behavior in lytic versus latent infections

RNA-seq analysis of HHV-6A has revealed pervasive splicing events that are conserved between HHV-6A and HHV-6B , which may impact the expression of various viral genes including U34. Understanding these regulatory mechanisms could provide additional insights into U34 function during different phases of infection.

What are the key unanswered questions about U34 structure and function?

Several important questions about U34 remain to be addressed:

  • The atomic structure of the HHV-6A nuclear egress complex

  • The specific residues mediating U34-U37 interaction

  • Potential post-translational modifications of U34 and their functional significance

  • The role of U34 in different cell types relevant to HHV-6A tropism

  • Comparative analysis of U34 function in HHV-6A versus HHV-6B

How might U34 be targeted for antiviral development?

As a critical component of viral egress, U34 represents a potential target for antiviral development. Strategies might include:

  • Small molecules that disrupt the U34-U37 interaction

  • Compounds that prevent proper localization of U34 to the nuclear membrane

  • Peptide inhibitors that mimic interaction interfaces

  • PROTAC approaches to promote U34 degradation

Detailed structural information would greatly facilitate these efforts by enabling structure-based drug design approaches.

What techniques are emerging that could advance our understanding of U34 biology?

Emerging technologies that could advance U34 research include:

  • Cryo-electron tomography to visualize NEC structures in situ

  • Single-molecule tracking to monitor U34 dynamics in living cells

  • CRISPR-based approaches for precise genome editing of viral sequences

  • Proteomics techniques to identify the complete interactome of U34

  • Advanced computational modeling to predict structural dynamics of the NEC

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.