Recombinant Human herpesvirus 6B G-protein coupled receptor homolog U51 (U51)

Shipped with Ice Packs
In Stock

Product Specs

Buffer
The storage buffer varies depending on the delivery format. For liquid preparations, a Tris/PBS-based buffer containing 5-50% glycerol is used. Lyophilized powder is prepared using a Tris/PBS-based buffer with 6% Trehalose prior to lyophilization.
Form
Liquid or Lyophilized Powder
Note: While we prioritize shipping the format currently in stock, specific format requests can be accommodated. Please indicate your preference in order notes.
Lead Time
Delivery times vary based on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, the liquid form has a 6-month shelf life at -20°C/-80°C, while the lyophilized form maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
N-terminal 10xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-301aa
Mol. Weight
37.3 kDa
Protein Length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Biochemicals
Source
in vitro E.coli expression system
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Target Names
U51
Target Protein Sequence
MEKETKSLAWPATAEFYGWVFIFSSIQLCTVVFLTVRFNGFKVGREYAVFTFAGMSFNCFLLPIKMGLLSGHWTLPRDFCAILLYIDDFSAYFSSWSLVFMAIERINYFCYSTPLLNENSKALAKVCFPIVWVVSGVQALQMLNNYKATALQNETGQCFLAFLRSGHDMWLMLVYSVVIPVMLVFFYLYSKNFMLLKDELSSVTTYLCIYLLLGTIAHLPKAALSEIESDKIFYGLRDIFMALPVLKVYYISAMAYCMACDDHTVPVRLCSIWLVNLCKKCFSCTRREKGSDLEVGIKMLK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Database Links

KEGG: vg:1497053

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Host cell membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional characterization of HHV-6B U51?

HHV-6B U51 is one of two 7-transmembrane (7-tm) receptor homologs encoded by Human Herpesvirus 6. It belongs to the UL78 gene family and shares structural similarities with human G-protein coupled receptors (GPCRs) . Functionally, U51 has been identified as a positive regulator of viral replication, potentially through promotion of membrane fusion and facilitation of cell-to-cell spread . The protein has demonstrated binding affinity to CC chemokines, including RANTES, with nanomolar affinity, suggesting a role in modulating host chemokine responses .

How does U51 contribute to HHV-6B replication and pathogenesis?

Research using RNA interference (RNAi) technology has demonstrated that U51 makes a significant contribution to viral replication. When U51 expression is knocked down using short interfering RNAs (siRNAs), viral DNA replication is reduced approximately 50-fold, and virally-induced cytopathic effects are significantly inhibited . This experimental evidence supports that U51 plays a crucial role in the HHV-6B replication cycle. The mechanism appears to involve enhancement of membrane fusion activities, which facilitates viral spread between cells . This contrasts with other viral GPCRs that may primarily function through signaling pathways rather than direct effects on membrane dynamics.

What experimental models are most appropriate for studying HHV-6B U51 function?

For studying U51 function, human T-cell lines (particularly SupT1 cells) represent an appropriate model system as they are susceptible to HHV-6 infection and support complete viral replication . RNA extraction followed by real-time PCR using U51-specific primers and probes allows for quantification of U51 expression levels, normalized against housekeeping genes such as GAPDH . For protein detection, immunofluorescence assays using U51-specific antibodies raised against synthetic peptides from U51 sequence regions have proven effective. These antibodies can detect both HHV-6A and HHV-6B U51 proteins in virus-infected cell cultures .

How can RNA interference be optimized to study U51 function in HHV-6B replication?

An effective RNA interference approach for studying U51 function involves:

  • Design of siRNAs specifically targeting the U51 gene sequence, with careful consideration of specificity and efficiency

  • Stable expression of these siRNAs in HHV-6-susceptible T cells prior to viral infection

  • Implementation of appropriate controls, including:

    • Scrambled derivatives of the U51-specific siRNA

    • Irrelevant siRNAs targeting unrelated sequences

    • Positive controls targeting essential viral genes (e.g., glycoprotein B)

  • Validation through "add-back" experiments using a human codon-optimized version of U51 that lacks homology to the sequences targeted by the siRNA

This comprehensive approach allows researchers to confidently attribute observed effects specifically to U51 knockdown rather than off-target effects of the RNAi procedure .

What methodological approaches are effective for studying U51 signaling properties?

When investigating U51 signaling properties, researchers should:

  • Establish stable cell lines expressing U51 using appropriate expression vectors

  • Utilize receptor binding assays with labeled ligands to characterize binding affinities

  • Implement functional assays to measure downstream signaling events, such as calcium flux, cAMP levels, or phosphorylation of signaling proteins

  • Perform comparative analyses with human GPCRs, particularly those with structural similarity to U51

For ligand binding studies, specific protocols include using labeled chemokines or other potential ligands such as opioid receptor ligands ([³H]DAMGO, [³H]naltrindole, [³H]DPDPE, [³H]U69,593, [³H]bremazocine, or the nonselective antagonist [³H]diprenorphine) . Non-specific binding should be determined by including excess unlabeled compound (e.g., 10 μM naloxone) .

How can synthetic peptides derived from U51 sequences be used to study potential autoimmune interactions?

For investigating potential autoimmune implications of U51, researchers can:

  • Identify potentially immunogenic synthetic peptides derived from HHV-6 U51 amino acid sequences through computational prediction tools

  • Design multiple synthetic peptides (approximately 30 different peptides) that represent various regions of the U51 protein

  • Implement suspension multiplex immunological assays (SMIA) to detect specific IgG and IgM antibodies against these peptides in patient samples

  • Include recombinant human proteins (CCR1, CCR3, CCR5) as controls to assess potential cross-reactivity and autoantibody formation

  • Compare antibody profiles between patients with suspected autoimmune conditions and healthy controls

This approach has successfully identified HHV-6 peptide-specific antibodies in autoimmune thyroiditis patients, with stronger signals for IgM antibodies indicating active HHV-6 infection .

What strategies can address potential confounding variables in U51 functional studies?

When designing experiments to study U51 function, researchers must consider several potential confounding variables:

Potential Confounding VariableControl Strategy
Expression level variabilityStable cell lines with verified expression levels; quantitative Western blotting
Off-target effects of siRNAMultiple siRNA sequences; scrambled controls; add-back experiments
Cell type-specific effectsTesting in multiple relevant cell types (T-cells, epithelial cells)
Virus strain differencesComparative studies with both HHV-6A and HHV-6B
Endogenous GPCR expressionBaseline characterization of host cell receptor expression profile
Temporal aspects of expressionTime-course experiments with synchronized infection

Implementing these control strategies ensures more robust interpretation of experimental results and reduces the risk of misattributing observed effects .

How should researchers interpret U51 binding data to chemokines in the context of viral pathogenesis?

When analyzing U51 binding data to chemokines such as RANTES, researchers should:

  • Establish clear dose-response curves with appropriate controls

  • Calculate binding affinities (Kd values) using Scatchard analysis or similar approaches

  • Compare binding affinities across multiple chemokines to establish specificity profiles

  • Correlate binding data with functional outcomes in cellular assays

  • Consider the physiological concentrations of chemokines during viral infection

Interpretation should acknowledge that while U51 has demonstrated nanomolar affinity for certain CC chemokines, the functional significance of this binding requires additional evidence linking it to specific signaling outcomes or virological effects . The potential antagonism or modulation of host chemokine networks should be considered within the broader context of viral immune evasion strategies.

What statistical approaches are most appropriate for analyzing HHV-6B U51 knockdown effects on viral replication?

For analyzing U51 knockdown effects on viral replication, these statistical approaches are recommended:

  • Multiple experimental replicates (minimum n=3) to account for biological variability

  • Appropriate normalization to control conditions

  • Log transformation of viral load data if not normally distributed

  • Analysis of variance (ANOVA) followed by post-hoc tests for multiple comparisons

  • Regression analysis to establish dose-dependent relationships between U51 expression and viral replication

  • Consideration of potential threshold effects in U51 function

The statistical significance of observed 50-fold reductions in viral DNA replication should be rigorously evaluated using these approaches to establish confidence in the biological relevance of U51 to the viral life cycle .

How can immune response data to U51 peptides be integrated with clinical observations in autoimmune diseases?

Researchers investigating potential connections between HHV-6B U51 and autoimmune conditions should:

  • Correlate antibody responses to specific U51 peptides with clinical parameters (disease severity, duration, treatment response)

  • Perform longitudinal studies to track changes in antibody titers over disease course

  • Compare antibody specificity profiles between different autoimmune conditions

  • Assess potential molecular mimicry between U51 epitopes and human GPCR sequences

  • Evaluate functional consequences of patient-derived antibodies on receptor signaling

This integrative approach has shown promise in autoimmune thyroiditis research, where HHV-6 peptide-specific IgG and IgM antibodies were detected in patients, with concurrent signals for anti-CCR1 and anti-CCR5 antibodies suggesting potential autoimmune cross-reactivity .

What experimental designs best address the multifunctional nature of U51 in different cell types?

To comprehensively study the potentially diverse functions of U51 across different cellular contexts:

  • Implement parallel experimental approaches in multiple relevant cell types:

    • T lymphocytes (primary targets of HHV-6B)

    • Epithelial cells (important for viral transmission)

    • Peripheral blood mononuclear cells (involved in immune responses)

  • Utilize a matrix experimental design that systematically varies:

    • U51 expression levels (through controlled expression systems)

    • Cellular activation states (resting vs. stimulated)

    • Environmental conditions (cytokine milieu, oxygen tension)

  • Measure multiple outcome parameters simultaneously:

    • Viral replication efficiency

    • Cell-to-cell fusion and syncytium formation

    • Chemokine receptor signaling

    • Inflammatory mediator production

This comprehensive approach acknowledges the complex biology of viral GPCRs and their potential to function differently depending on cellular context and microenvironment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.