Recombinant Human herpesvirus 6B Protein U22 (U22)-VLPs

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Herpesvirus 6B Protein U22 (U22)-VLPs

Recombinant Human herpesvirus 6B (HHV-6B) Protein U22-VLPs are engineered virus-like particles (VLPs) incorporating the U22 protein from HHV-6B. These constructs are used in research to study viral structure, immune interactions, and potential therapeutic or vaccine applications. U22 is one of three HHV-6-specific open reading frames (ORFs) absent in HHV-7, suggesting unique roles in HHV-6 pathobiology .

Genomic Context

HHV-6B U22 is encoded within the U20–U26 gene cluster, a region exclusive to roseoloviruses (HHV-6A, -6B, -7) . This cluster includes genes linked to immune evasion and viral persistence. U22 is distinct from U20 and U21, which are characterized as glycoproteins with class I MHC-like folds involved in host immune modulation .

FeatureDetail
Genome LocationUnique segment (U) of HHV-6B, flanked by direct repeats (DR) .
ORF SpecificityPresent in HHV-6A/6B but absent in HHV-7 .
Sequence Length1–202 amino acids (aa) .

Current Knowledge Gaps

While U20 and U21 are well-characterized as immune evasins (e.g., U20 binds ULBP1 to block NK cell activation ), U22’s function remains unexplored. Its inclusion in VLPs suggests potential roles in:

  • Viral entry: Transmembrane domains may mediate host-cell binding.

  • Immune modulation: Similar to U20/U21, though no ligand interactions are reported.

Comparative Genomic Analysis

U22 shares structural homology with other roseolovirus proteins but lacks functional characterization. Below is a comparison with U20/U21:

ProteinFunctionMechanismSource
U20Binds ULBP1; inhibits NK cell activation .Direct ligand-receptor interaction.
U21Redirects MHC-I to lysosomes .Mimics MHC-I structural folds.
U22UnknownHypothetical role in viral assembly.

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will ship the product in lyophilized form with standard blue ice packs by default. However, if you require liquid form, it must be shipped with dry ice. Please communicate your preference in advance, as additional fees will apply for dry ice and dry ice containers.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: Delivery time may differ based on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. Upon receipt, store the protein at -20°C/-80°C and avoid repeated freezing and thawing to maintain protein activity.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you have a specific tag type in mind, please inform us, and we will assess its feasibility for development.
Synonyms
U22; Protein U22
Datasheet & Coa
Please contact us to get it.
Expression Region
1-202aa
Research Area
others
Source
Mammalian cell
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Target Names
U22
Target Protein Sequence
MVPQGWSLAWVSVLYVSVIPSLHIINNENSVFIGTHSETELRHWLIFVKMAQRSGTAWWRMASVPINAYFERDIAFLFNPRCVIETALGSKILCRYNKNIGVVFVDNDTTCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRKERRRFLPRYERFVYYCISVYLFAVAVFCSCWFALDPLFNMWA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Database Links

KEGG: vg:1497024

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What are HHV-6B U22-VLPs and how do they differ from native virions?

U22-VLPs are self-assembled structures that incorporate the U22 late protein of HHV-6B but lack viral genetic material. Unlike complete virions, these particles maintain the structural properties of HHV-6B without the ability to replicate. U22 is expressed during the lytic replication cycle . VLPs generally maintain the same structural properties as virions without containing the genome, making them safer for research and biomedical applications . The primary difference between U22-VLPs and native HHV-6B virions is the absence of viral DNA, rendering U22-VLPs non-infectious while preserving antigenic properties.

What are the primary methods for producing recombinant HHV-6B U22-VLPs?

Production of recombinant HHV-6B U22-VLPs typically involves heterologous expression systems. Based on established VLP production methodologies, recombinant U22 protein can be expressed in various systems including insect cells using baculovirus expression vectors (BEVS) , bacterial expression systems, or mammalian cell lines. For optimal yield and quality, parameters such as cell concentration at infection (CCI), multiplicity of infection (MOI), and time of harvest (TOH) should be carefully optimized using response surface methodology (RSM) . The expressed U22 proteins can self-assemble into VLPs, which can then be purified using techniques such as size exclusion chromatography and characterized using methods like native PAGE, SDS-PAGE, and dynamic light scattering .

How can the morphology and structural integrity of U22-VLPs be assessed?

Morphological assessment of U22-VLPs requires multiple complementary techniques:

TechniquePurposeInformation Provided
Cryo-TEMStructural visualizationHigh-resolution images without dehydration artifacts
SECSeparation by sizeDistinguishes assembled particles from components
DLSSize distributionMeasures hydrodynamic diameter in solution
Native PAGEAssembly stateConfirms intact particle formation
SDS-PAGEProtein integrityVerifies individual protein components

These techniques collectively provide comprehensive assessment of U22-VLP morphology, size consistency, and structural integrity, similar to methods used for other VLP systems.

What role does U22 play in HHV-6B pathogenesis, and how does this inform the design of U22-VLPs?

U22 is a late viral lytic transcript of HHV-6B , indicating its involvement in the later stages of viral replication or assembly. While specific functions of U22 in HHV-6B pathogenesis remain partially characterized, its temporal expression pattern suggests it may play a role in virion maturation. Understanding this role is crucial for U22-VLP design, as it informs which structural elements must be preserved for the VLPs to mimic relevant viral epitopes. The design of U22-VLPs should consider potential interactions of U22 with other viral or host proteins, particularly in light of HHV-6B's immune evasion strategies such as downregulation of MHC-I molecules and stress ligands like MICB, ULBP1, and ULBP3 .

How do U22-VLPs interact with the host immune system compared to native HHV-6B virions?

U22-VLPs likely stimulate immune responses similar to those triggered by native HHV-6B virions but without infectious consequences. Based on general VLP immunology, U22-VLPs would stimulate innate immunity through TLRs and Pattern recognition receptors (PRRs), induce strong humoral responses including IgM production in a T-cell independent manner, and enhance antigen uptake, processing, and presentation by APCs through both MHC I and MHC II pathways . Unlike native virions, U22-VLPs lack the viral immune evasion mechanisms that depend on active viral gene expression, such as the U20 glycoprotein-mediated downregulation of MHC-I and stress ligands . This difference may result in more robust immune recognition of U22-VLPs compared to native virions.

What modifications can be made to U22-VLPs to enhance their utility in targeted delivery applications?

Similar to other VLP systems, U22-VLPs can be modified through various strategies:

  • Surface modification through chemical conjugation can attach targeting ligands, such as antibodies or aptamers, to direct the VLPs to specific cell types

  • Internal modification can incorporate therapeutic payloads, leveraging the natural ability of VLPs to assemble around nucleic acids

  • Hybrid VLPs incorporating both U22 and other viral or non-viral proteins may offer additional functionality

  • For photodynamic therapy applications, U22-VLPs could be modified with photosensitizers and targeting moieties, similar to the approach demonstrated with other VLP systems

These modifications must be validated to ensure they don't compromise VLP assembly, stability, or target recognition.

How can response surface methodology (RSM) be applied to optimize the production of HHV-6B U22-VLPs?

RSM can be systematically applied to optimize U22-VLP production by modeling the relationship between multiple process parameters and output responses:

  • Identify critical parameters affecting U22-VLP production, typically including cell concentration at infection (CCI), multiplicity of infection (MOI), and time of harvest (TOH)

  • Employ a central composite design or Box-Behnken design to establish experimental conditions covering the parameter space

  • Perform statistical analysis to identify significant parameters and their interactions

  • Develop predictive models for responses such as VLP yield, purity, and quality

  • Combine multiple responses through multiple-criteria decision analysis (MCDA) to determine global optimum conditions

This approach allows for efficient process optimization with fewer experiments than one-variable-at-a-time methods.

What are the challenges in distinguishing between U22-VLPs and extracellular vesicles during purification and characterization?

Distinguishing U22-VLPs from extracellular vesicles (EVs) presents significant challenges due to overlapping size ranges and similar biophysical properties. As noted in VLP production studies, "remarkable quantities of extracellular vesicles" can be present alongside VLPs . Purification strategies must employ multiple orthogonal techniques:

  • Density gradient ultracentrifugation can separate VLPs from EVs based on density differences

  • Size exclusion chromatography combined with dynamic light scattering helps separate particles based on size

  • Immunological methods targeting U22-specific epitopes enhance specificity

  • Electron microscopy with immunogold labeling provides visual confirmation of U22 presence

  • Comprehensive characterization requires combining these approaches with proteomic analysis to distinguish VLP-associated proteins from EV markers

What analytical techniques are most effective for quantifying the purity and yield of U22-VLPs?

A multi-modal analytical approach is essential for comprehensive U22-VLP characterization:

TechniquePurposeInformation Provided
Nanoparticle tracking analysis (NTA)Concentration & sizeCount-based quantification
BCA/Bradford assayTotal proteinQuantification of protein content
ELISA/Western blottingSpecific proteinQuantification of U22 content
SEC-MALSSize & molecular weightOrthogonal characterization
Cryo-electron microscopyStructural visualizationDirect visualization of particle integrity
Flow virometryIndividual particle analysisDistinguishes assembled VLPs from fragments

Integration of these complementary methods provides a comprehensive profile of U22-VLP quality attributes.

How can researchers effectively characterize the immunogenicity of U22-VLPs for vaccine development?

Characterizing U22-VLP immunogenicity requires a systematic progression:

  • In vitro studies:

    • Evaluate U22-VLP interaction with antigen-presenting cells

    • Measure uptake efficiency and dendritic cell activation markers (CD80, CD86, MHC-II)

    • Assess T cell activation through proliferation and cytokine profiles

  • In vivo studies:

    • Compare different doses, schedules, adjuvants, and routes of administration

    • Quantify anti-U22 antibody titers and determine antibody isotypes

    • Assess neutralizing capacity against HHV-6B

    • Evaluate memory B cell responses through ELISpots

    • Determine T cell specificity and functionality through re-stimulation assays

VLPs are particularly effective at stimulating both humoral and cellular immunity due to their particulate nature and ability to be efficiently taken up by dendritic cells .

What are the key considerations for designing U22-VLPs with enhanced cellular uptake properties?

Designing U22-VLPs with optimized cellular uptake requires strategic modifications:

  • Size optimization: The natural diameter of VLPs (20-200 nm) facilitates lymphatic drainage and uptake by dendritic cells

  • Surface charge modification: Slightly positive zeta potentials often enhance uptake

  • Targeting ligands: Antibodies, aptamers, or peptides conjugated to the VLP surface enable cell-specific recognition

  • Cell-penetrating peptides: May enhance endosomal escape after cellular uptake

Evaluation methods should include quantitative uptake studies using fluorescently labeled U22-VLPs and mechanistic studies employing endocytosis inhibitors to identify predominant uptake pathways.

How do post-translational modifications of the U22 protein affect VLP formation and functionality?

Post-translational modifications (PTMs) of U22 protein significantly impact VLP assembly, stability, and functionality:

  • As a late viral protein, U22 likely undergoes various PTMs in its native context

  • The expression system selected for recombinant production critically determines which PTMs occur

  • Glycosylation particularly affects protein folding, solubility, and antigenic properties

  • Phosphorylation status may influence protein-protein interactions during assembly

Characterization approaches include:

  • Mass spectrometry-based proteomics to map the PTM landscape

  • Site-directed mutagenesis of putative modification sites

  • Comparative studies of U22-VLPs produced in different expression systems

What techniques are available for studying the binding interactions between U22-VLPs and target cells or receptors?

Multiple complementary techniques provide insights into U22-VLP interactions:

TechniquePurposeKey Advantages
Surface plasmon resonance (SPR)Binding kineticsReal-time, label-free measurement
Bio-layer interferometry (BLI)Binding kineticsSimilar to SPR with different advantages
Flow cytometryCellular bindingQuantifies binding to different cell populations
Confocal microscopyCellular localizationVisualizes internalization
Cryo-electron microscopyStructural visualizationPotential visualization of VLP-receptor complexes

These techniques, used in combination, provide comprehensive characterization of the binding mechanisms underlying U22-VLP interactions with target cells and receptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.