Recombinant Human herpesvirus 6B Protein U22 (U22)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Herpesvirus 6B Protein U22 (U22)

Recombinant Human Herpesvirus 6B Protein U22 (U22) is a virally encoded glycoprotein expressed during the late phase of HHV-6B infection. It is part of the U20-U26 gene cluster unique to the Roseolovirus genus and plays roles in viral structure, immune evasion, and infection dynamics . The recombinant form is produced using E. coli expression systems for research applications, enabling studies on its biochemical properties and interactions with host cells .

Genomic Context

  • U22 is located within the HHV-6B genome’s unique (U) segment and is conserved in HHV-6A but absent in HHV-7 .

  • It is transcribed as a late gene during viral replication, with expression peaking 24–72 hours post-infection .

Transcriptional Regulation

  • U22 mRNA is detectable 12–24 hours post-infection in Molt-3 T cells, with expression sustained through 72 hours .

  • Its transcription is dependent on viral DNA replication, as phosphonoacetic acid (a DNA polymerase inhibitor) suppresses U22 expression .

Knowledge Gaps and Future Directions

  1. Functional Mechanism: The precise role of U22 in viral entry, immune evasion, or virion structure remains uncharacterized.

  2. Interaction Partners: No studies have identified host proteins or pathways directly regulated by U22.

  3. Therapeutic Potential: U22’s immunogenicity warrants exploration as a vaccine candidate or diagnostic marker .

References to Key Studies

  • Genomic Annotation: U22’s genetic context and conservation were detailed in HHV-6B strain Z29 sequencing .

  • Transcriptomic Profiling: RNA-seq data revealed U22’s late-phase expression kinetics .

  • Recombinant Production: Technical specifications were sourced from Echo Biosystems’ recombinant protein documentation .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is Tris/PBS-based buffer with 5%-50% glycerol. For lyophilized powder, the buffer used before lyophilization is Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will prepare according to your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
U22; Protein U22
Datasheet & Coa
Please contact us to get it.
Expression Region
1-202aa
Mol. Weight
26.3 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
others
Source
in vitro E.coli expression system
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Target Names
U22
Target Protein Sequence
MVPQGWSLAWVSVLYVSVIPSLHIINNENSVFIGTHSETELRHWLIFVKMAQRSGTAWWRMASVPINAYFERDIAFLFNPRCVIETALGSKILCRYNKNIGVVFVDNDTTCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRKERRRFLPRYERFVYYCISVYLFAVAVFCSCWFALDPLFNMWA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Database Links

KEGG: vg:1497024

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Human Herpesvirus 6B U22 protein and what is its significance in viral biology?

U22 is a late viral lytic transcript and protein expressed during HHV-6B infection. It is encoded by a highly conserved region of the HHV-6 genome that is specific to HHV-6 and distinct from other herpesviruses . The conservation of this gene between HHV-6A and HHV-6B variants makes it an ideal target for viral detection and quantification purposes.

U22 is particularly valuable for research applications because:

  • It serves as a reliable marker for viral replication stages, being expressed as a late transcript during the lytic cycle

  • Its sequence is sufficiently conserved to allow detection of both HHV-6A and HHV-6B with the same primers

  • It can be detected in infected cells through multiple time points post-infection, making it suitable for monitoring viral kinetics

  • It is detectable by nested PCR even when expressed at low levels, allowing for sensitive detection of viral presence

How is the U22 gene utilized in HHV-6 detection and quantification systems?

The U22 gene has become a standard target for HHV-6 detection and quantification for several methodological reasons:

  • Real-time PCR target: The U22 gene region is commonly used for designing primers and probes for quantitative PCR assays. For example, primers 397F (5′-TCG AAA TAA GCA TTA ATA GGC ACA CT-3′) and 493R (5′-CGG AGT TAA GGC ATT GGT TGA-3′) amplify a 99-bp fragment from both HHV-6A and HHV-6B variants .

  • Standard curve generation: Plasmids containing the U22 gene sequence are used to establish standard curves for absolute quantification, allowing researchers to determine viral copy numbers in clinical and research samples .

  • Viral load monitoring: U22-based assays enable monitoring of viral DNA accumulation in infected cells and viral progeny production in culture supernatants .

  • Distinguishing active infection from latency: Detection of U22 transcripts can help differentiate between active viral replication and latent infection states .

What are the key differences between HHV-6A and HHV-6B U22 genes that researchers should be aware of?

While the U22 gene is highly conserved between HHV-6A and HHV-6B, researchers should be aware of several important distinctions:

  • Sequence variations: Despite high conservation, there are specific nucleotide differences between HHV-6A and HHV-6B U22 genes that can be used for variant-specific detection if needed .

  • Amplification efficiency: Standard curves generated from plasmids containing either HHV-6A (GS strain) or HHV-6B (Z29 strain) U22 sequences demonstrate similar amplification efficiencies, suggesting that quantification assays can reliably detect both variants with similar sensitivity .

  • Recombination potential: The first interspecies recombinant between HHV-6A and HHV-6B has been documented, which could potentially affect U22 sequence in recombinant viruses . This phenomenon, while well-established in alphaherpesviruses, was previously unobserved in betaherpesviruses.

How are U22-containing plasmids prepared for use as standards in HHV-6 quantitation?

The preparation of U22 plasmid standards follows this methodological approach:

  • DNA extraction and amplification: DNA is extracted from reference strains (e.g., HHV-6A GS strain and HHV-6B Z29 strain) and the U22 target region is amplified using specific primers (e.g., 397F and 493R) .

  • Cloning process: The amplified 99-bp fragments are cloned into appropriate vectors, such as the PCR 2.1 TA cloning vector .

  • Verification and purification: The resulting plasmids are fully sequenced to confirm accuracy before expansion and purification .

  • Quantification: The concentration of purified plasmid DNA is determined by spectroscopy at 260 nm, and the corresponding copy number is calculated based on plasmid size .

  • Standard curve generation: Serial dilutions (typically 10-fold) are prepared, ranging from 1 to 10⁷ copies per reaction, and amplified in triplicate to generate standard curves for quantitative PCR assays .

How do metabolic inhibitors affect U22 expression and what does this reveal about HHV-6 replication requirements?

Research using metabolic inhibitors has provided important insights into the relationship between cellular metabolism and HHV-6 replication through monitoring U22 expression:

  • Glycolysis inhibition: Treatment of HHV-6A-infected cells with 2-deoxy-D-glucose (2-DG, 1 mM) significantly reduces viral U22 gene expression, viral protein accumulation, and progeny virus production, demonstrating the virus's dependence on glycolysis .

  • mTOR pathway inhibition: Both rapamycin (100 nM) and Torin1 (5 nM) treatments substantially decrease U22 gene expression and viral replication, indicating that HHV-6 requires the mTOR signaling pathway for efficient replication .

This experimental approach using U22 as a marker reveals that:

  • HHV-6 replication is highly dependent on host cell metabolism

  • The virus promotes glycolysis in infected cells

  • The regulatory mechanisms induced by HHV-6 infection differ from those observed with other herpesviruses

How can researchers distinguish between active HHV-6 infection and chromosomally integrated HHV-6 (ciHHV-6) using U22-based assays?

Distinguishing active HHV-6 infection from chromosomally integrated HHV-6 (ciHHV-6) is a critical challenge in HHV-6 research. U22-based detection methods can assist in this differentiation:

What are the implications of copy number heterogeneity and large origin tandem repeats for U22-based viral quantification?

Recent deep sequencing studies of HHV-6 reference strains have revealed significant genomic complexity that affects viral quantification methods, including those targeting U22:

  • Copy number variations: Multiple loci in HHV-6 reference materials show copy number variations of up to 20 times, which can significantly impact quantitative PCR results if primers target these variable regions .

  • Origin amplifications: Nine out of 15 examined HHV-6 strains exhibited high-copy-number tandem-repeat amplifications in the origin of replication . These genomic duplications can affect the accuracy of viral quantification.

  • Strain differences: Different strains may contain varied genomic arrangements that affect the reliability of quantification assays. Researchers should validate their U22-based assays against multiple reference strains to ensure accuracy across viral variants .

  • Standard selection impact: These genomic variations critically inform the selection process for standard materials in PCR testing and highlight the need for careful characterization of reference strains .

How can U22 expression patterns be used to study HHV-6 latency establishment?

U22 expression analysis provides valuable insights into the transition between lytic replication and latency:

  • Transcriptional patterns: In lymphatic endothelial cells (LECs) infected with HHV-6, U22 transcripts (representing late lytic genes) are detected by first-round PCR only during the first 3 days post-infection but can be detected by nested PCR until 14 days post-infection . This suggests a gradual decline in lytic gene expression.

  • Comparison with latency-associated transcripts: Unlike U22, the latency-associated transcript U94/rep remains consistently detectable by first-round PCR throughout infection, even when lytic genes like U22 are expressed at low levels .

  • Viral genome persistence: Despite reduced U22 expression, viral genomes persist intracellularly at levels of 10⁷ to 6×10⁶ genome equivalents in 10⁶ cells for up to 21 days post-infection, indicating establishment of a non-productive infection state .

What is the recommended protocol for real-time PCR quantification of HHV-6 using U22 primers?

Based on established research methodologies, the following protocol is recommended for U22-based HHV-6 quantification:

Primer and Probe Selection:

  • Forward primer (397F): 5′-TCG AAA TAA GCA TTA ATA GGC ACA CT-3′

  • Reverse primer (493R): 5′-CGG AGT TAA GGC ATT GGT TGA-3′

  • These primers amplify a 99-bp fragment from both HHV-6A and HHV-6B U22 genes

Standard Preparation:

  • Clone the 99-bp U22 fragment from HHV-6A (GS strain) or HHV-6B (Z29 strain) into a suitable vector (e.g., PCR2.1-TOPO plasmid)

  • Quantify the plasmid by UV spectroscopy

  • Prepare serial dilutions ranging from 1 to 10⁷ copies per reaction

Sample Processing:

  • Extract total DNA from clinical specimens or cell cultures

  • For viral replication studies, separate cellular and supernatant fractions before DNA extraction

  • Include appropriate positive and negative controls with each run

PCR Conditions:

  • Use a standard real-time PCR protocol with appropriate cycling conditions for your specific reagents and instrument

  • Run samples and standards in triplicate to ensure reliability

  • Include internal control amplification (e.g., β-actin) for normalization of cellular samples

Data Analysis:

  • Generate a standard curve from plasmid dilutions

  • Calculate viral copy numbers in test samples based on the standard curve

  • For cellular samples, normalize results to the number of cells (using β-actin or another housekeeping gene)

How should researchers interpret U22 PCR results in different clinical and research contexts?

The interpretation of U22 PCR results requires careful consideration of multiple factors:

In Viral Replication Studies:

  • High U22 DNA levels in cellular fractions with increasing levels in supernatants over time indicate productive infection

  • Decreasing extracellular viral DNA from ~10⁶ genomes/mL at early time points to ~2×10² genomes/mL at later time points suggests transition to a non-productive state

In Clinical Specimens:

  • HHV-6 levels in whole blood exceeding 5.5 log₁₀ copies/ml suggest chromosomally integrated HHV-6 (ciHHV-6)

  • A ratio of viral to human genomes of approximately 1:1 confirms ciHHV-6

  • Viral DNA detection in plasma/serum can be misleading due to possible release from cells harboring ciHHV-6

In Transplant Recipients:

  • High HHV-6 DNA loads in ciHHV-6 patients may lead to erroneous diagnosis of active infection

  • Monitoring both DNA levels and virus-specific mRNA expression can help distinguish between ciHHV-6 and active infection

What controls should be included when using U22 for viral quantification?

To ensure reliable results in U22-based HHV-6 quantification, the following controls should be included:

Positive Controls:

  • Plasmid standards containing known copy numbers of the U22 target sequence

  • DNA extracted from laboratory reference strains (e.g., HHV-6A GS strain or HHV-6B Z29 strain)

  • Positive clinical specimens with confirmed HHV-6 infection

Negative Controls:

  • No-template controls to detect contamination

  • DNA from uninfected cells to confirm specificity

  • DNA from related herpesviruses to verify assay specificity

Internal Controls:

  • Housekeeping gene amplification (e.g., β-actin) for normalization and sample quality assessment

  • Spike-in controls for monitoring extraction efficiency

  • Inhibition controls to detect PCR inhibitors in clinical specimens

Variant Controls:

  • Both HHV-6A and HHV-6B reference materials to verify cross-reactivity

  • Known ciHHV-6 samples for threshold validation

  • Serial dilutions to establish assay linearity and dynamic range

How can RT-PCR for U22 transcripts be optimized to distinguish different phases of viral infection?

RT-PCR detection of U22 transcripts can be optimized to distinguish between different phases of HHV-6 infection:

Primer Design Considerations:

  • Design nested PCR primers for increased sensitivity when detecting low-level U22 expression during transitional or latent phases

  • Include primers for immediate-early (e.g., U42), late (U22), and latency-associated (U94/rep) transcripts to differentiate infection stages

Sampling Timeline:

  • Collect samples at multiple time points (e.g., days 1, 3, 7, 14, and 21 post-infection) to track changes in expression patterns

  • Compare U22 transcript levels across these time points to identify transitions between lytic and latent states

Technical Optimization:

  • Ensure comparable sensitivity across all gene targets (e.g., ability to detect 1,000 target molecules after first-round PCR and 50-100 molecules after nested PCR)

  • Use both first-round and nested PCR to detect different levels of gene expression

  • Include appropriate DNase treatment to eliminate genomic DNA contamination

Interpretation Framework:

  • First-round PCR positivity for U22 in early infection (1-3 days) followed by negativity indicates high initial expression followed by downregulation

  • Nested PCR positivity for U22 until 14 days post-infection with simultaneous first-round PCR positivity for U94/rep suggests transition to a non-productive state

  • Complete absence of U22 transcripts with persistent U94/rep expression indicates latency

What are the potential pitfalls in interpreting U22-based HHV-6 quantification results?

Researchers should be aware of several potential pitfalls when interpreting U22-based HHV-6 quantification results:

Chromosomally Integrated HHV-6:

  • ciHHV-6 patients will show high viral DNA levels in whole blood samples without active infection

  • This can lead to misdiagnosis and unnecessary antiviral treatment if not properly identified

  • Monitoring DNA in plasma/serum is unreliable for distinguishing ciHHV-6 due to cell lysis and DNA release

Genomic Variations:

  • Copy number heterogeneity and large tandem repeats in reference strains can affect quantification accuracy

  • Different HHV-6 strains may have undergone significant changes during culture, similar to WHO BK and JC strains

  • Nine of 15 examined strains had high-copy-number tandem-repeat amplifications that may impact PCR testing

Technical Considerations:

  • PCR inhibitors in clinical samples may lead to false-negative results

  • Cross-reactivity between variants requires careful primer design and validation

  • Sensitivity differences between first-round and nested PCR must be considered when interpreting transcript detection results

Clinical Context:

  • Transplant recipients with ciHHV-6 may be at increased risk for bacterial infection and graft rejection

  • ciHHV-6 can be induced to active viral replication under certain conditions

  • The clinical significance of low-level HHV-6 reactivation remains poorly defined

How do interspecies recombination events between HHV-6A and HHV-6B affect U22-based detection methods?

The discovery of interspecies recombination between HHV-6A and HHV-6B has important implications for U22-based detection methods:

Recombination Impact:

  • The first documented interspecies recombinant between HHV-6A and HHV-6B represents a phenomenon previously known in alphaherpesviruses but not observed in betaherpesviruses until recently

  • Such recombination events may produce variants with chimeric genomic regions that could affect the reliability of PCR-based detection methods

Assay Design Considerations:

  • Primers and probes targeting the U22 region should be designed to detect both parental and potential recombinant sequences

  • Validation against known recombinant isolates is recommended to ensure detection capability

  • Sequencing of the amplified region may be necessary in unusual cases to identify potential recombinants

Research Implications:

  • Recombination events add complexity to viral epidemiology and phylogenetic studies

  • The frequency and clinical significance of such recombinants remain to be determined

  • Laboratories performing HHV-6 typing should be aware of the possibility of recombinant viruses

How should researchers address contradictory results from U22-based assays?

When faced with contradictory results from U22-based assays, researchers should consider the following approaches:

Methodological Verification:

  • Confirm assay sensitivity and specificity using well-characterized controls

  • Verify that primers and probes match the target sequence in the specific HHV-6 variant being studied

  • Check for potential PCR inhibitors or technical issues that might affect amplification efficiency

Multi-target Analysis:

  • Test additional viral genes beyond U22 to confirm results

  • Compare DNA detection results with RNA/transcript detection to differentiate active replication from latent or integrated virus

  • Include both immediate-early (U42) and late (U22) gene targets along with latency-associated transcripts (U94/rep)

Sample Considerations:

  • Evaluate different sample types (whole blood, plasma, PBMCs, tissue) as distribution of viral DNA may vary

  • Consider temporal dynamics, as contradictory results might reflect different phases of infection

  • Test sequential samples when possible to establish trends in viral load

Contextual Interpretation:

  • Consider the possibility of ciHHV-6, which can lead to apparently contradictory results

  • Evaluate results in light of clinical presentation and other laboratory findings

  • Remember that the regulatory pathway and mechanisms induced by HHV-6 infection might differ from other herpesviruses, potentially leading to unexpected findings

What emerging applications of U22 are advancing HHV-6 research?

Several emerging applications of U22 are pushing the boundaries of HHV-6 research:

Activation Studies:

  • U22 expression is being used to study virus activation in ciHHV-6 individuals following exposure to specific drugs or chemicals

  • Research questions include whether HDAC inhibitors, hydrocortisone, or anti-seizure drugs like valproic acid and carbamazepine can activate the virus in patients with ciHHV-6

Transplantation Research:

  • U22-based assays are helping determine the risks associated with blood transfusion, hematopoietic stem cell transplantation (HSCT), or solid organ transplantation (SOT) when donors or recipients have ciHHV-6

  • Studies are investigating whether ciHHV-6 transplant recipients face increased risks for bacterial infection and graft rejection

Transplacental Transmission:

  • U22 detection is being employed to study the risks of transplacental transmission of HHV-6 by ciHHV-6 mothers to their infants

  • This research aims to determine whether infants born to ciHHV-6 mothers are at risk for clinical manifestations associated with HHV-6 infection

Novel Therapeutic Targets:

  • The role of U22 in viral replication and metabolism is being investigated to identify potential therapeutic targets

  • Studies on how metabolic inhibitors affect U22 expression may lead to new antiviral strategies

How can functional studies of U22 contribute to understanding HHV-6 pathogenesis?

Functional studies of U22 can significantly enhance our understanding of HHV-6 pathogenesis:

Metabolic Regulation:

  • U22 expression studies reveal that HHV-6 promotes glycolysis in infected T cells

  • Further investigation of the relationship between U22 expression and metabolic changes could elucidate how the virus manipulates host cell metabolism

Virus-Host Interactions:

  • Analysis of U22 expression in different cell types can help identify cellular factors that regulate viral replication

  • Understanding how U22 interacts with host factors may reveal mechanisms of viral persistence and reactivation

Pathogenic Mechanisms:

  • Correlating U22 expression patterns with disease manifestations could identify associations between viral replication dynamics and clinical outcomes

  • Studies in immunocompromised hosts may reveal how altered U22 expression contributes to HHV-6-associated diseases

Therapeutic Development:

  • Targeting pathways that regulate U22 expression, such as the mTOR pathway, represents a potential therapeutic strategy

  • Identifying host factors that interact with U22 could lead to novel host-directed therapies

What technological advances will improve U22-based detection and characterization methods?

Emerging technologies are poised to enhance U22-based detection and characterization:

Next-Generation Sequencing (NGS):

  • Deep sequencing approaches can identify genomic variations in the U22 region across different viral isolates

  • NGS can detect low-frequency variants and recombination events that might be missed by traditional PCR methods

  • Whole-genome sequencing of viral isolates provides context for interpreting U22 expression in relation to other genomic features

Digital PCR:

  • Digital PCR technologies offer absolute quantification without reliance on standard curves

  • These methods can provide more accurate viral load measurements, particularly for samples with extremely high (ciHHV-6) or low copy numbers

  • Improved precision in quantification will enhance the ability to distinguish between active infection and ciHHV-6

Single-Cell Analysis:

  • Single-cell RNA sequencing can reveal cell-specific patterns of U22 expression

  • This approach may identify subpopulations of cells with distinct viral activity patterns

  • Understanding cellular heterogeneity in viral expression could explain variable disease manifestations

CRISPR-Based Technologies:

  • CRISPR-based diagnostic platforms targeting U22 sequences may provide rapid point-of-care testing options

  • Gene editing approaches can help elucidate U22 function through precise modifications of viral genomes

  • These technologies could revolutionize both detection and functional characterization of HHV-6 variants

How might U22 research contribute to addressing unresolved questions about ciHHV-6?

Research utilizing U22 detection and characterization has the potential to address several unresolved questions about chromosomally integrated HHV-6:

Activation Mechanisms:

  • U22 expression analysis can help determine whether individuals with ciHHV-6 experience viral activity that would benefit from intervention

  • Cell culture experiments monitoring U22 transcription can confirm whether ciHHV-6 can be activated in vitro by chemicals such as HDAC inhibitors and hydrocortisone

Clinical Significance:

  • Long-term monitoring of U22 expression in ciHHV-6 individuals could establish whether they are at increased risk for specific clinical manifestations

  • Correlation between U22 expression patterns and clinical outcomes may guide decisions about when antiviral therapy might be warranted in individuals with ciHHV-6

Horizontal Acquisition:

  • U22 sequence analysis can help determine whether individuals with ciHHV-6 can acquire HHV-6 horizontally through typical transmission routes

  • Distinguishing between integrated and exogenously acquired viral sequences would require detailed analysis of U22 and other genomic regions

Transmission Risks:

  • Monitoring U22 expression in various clinical scenarios could clarify whether there are increased risks associated with blood transfusion, HSCT, or SOT when donors or recipients have ciHHV-6

  • Such research would inform clinical guidelines for screening and management in transplantation settings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.