Recombinant Human herpesvirus 6B Protein U23 (U23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
U23; Protein U23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-299
Protein Length
Full Length of Mature Protein
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Target Names
U23
Target Protein Sequence
IIKTNAEHCSKRLFSFCYLGVGVIKKPLHLGNRKNMLFLSFLLVCLCEEVQMLNLTTTEV SATEFASIASKNMETNVSTSSDYLTGKSETTFSANPETWGKNVTEISIASVAYLNQSSMV TSTLAVGTTNRSSGNNVNVTTSSFPTVKGDEAQDIETFFTVILASTLSDVSEKTPQGLPT KSTPKKTVQALWETDTVQVPELTDTNEGDEEYFKDFLSSLVIWICGISFVGAFIIVIVIL YNWYKKDKQRSLLWDEENKPDVQIRRDAKTCR
Uniprot No.

Target Background

Database Links

KEGG: vg:1497100

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is HHV-6B U23 and how does it differ from other viral proteins?

U23 is a glycoprotein encoded by the HHV-6B genome that belongs to the unique genes (U20-U26) of the roseolovirus genus. Unlike some other HHV-6B proteins such as U20 and U21 which have well-characterized immune evasion functions, U23's precise role in viral pathogenesis remains less understood . Unlike U20, which binds directly to ULBP1 to mask it from NKG2D recognition, or U21, which targets MHC class I molecules for degradation, U23 has not been implicated in similar immune evasion strategies .

What is the expression pattern of U23 during HHV-6B infection?

Based on studies of HHV-6A U23 (which shares high homology with HHV-6B U23), this protein is expressed at the late phase of infection as a glycoprotein. Notably, U23 is not incorporated into virions but instead primarily localizes to the trans-Golgi network (TGN) in infected cells . During the HHV-6B replication cycle, different viral genes are expressed with specific kinetics - immediate-early (IE), early (E), and late (L) - with U23 falling into the late expression category as determined by transcriptome analyses .

What are the recommended methods for expressing recombinant HHV-6B U23 protein?

For recombinant expression of HHV-6B U23, researchers commonly use mammalian expression systems due to the glycosylated nature of the protein. Based on successful approaches with other HHV-6B glycoproteins, the following methods are recommended:

  • Mammalian expression systems: Transient transfection of Expi293 cells has been successful for expressing other HHV-6B glycoproteins and would be appropriate for U23 . For U23, which localizes to the trans-Golgi network, a mammalian system would preserve proper folding and post-translational modifications.

  • Purification strategy: For 6xHIS-tagged U23, purification on a Nickel-NTA column followed by size exclusion chromatography would be appropriate. For Fc-fusion constructs, protein A chromatography followed by size exclusion chromatography is recommended .

What detection methods are recommended for studying U23 expression in infected cells?

Based on approaches used for other HHV-6B proteins, the following methods are recommended for detecting U23:

  • RT-PCR: To quantify U23 mRNA expression levels during infection. This can be performed using RNA extracted from infected cells at different time points post-infection .

  • Western blotting: For detecting U23 protein expression using either antibodies against U23 or against epitope tags if using recombinant constructs .

  • Immunofluorescence microscopy: To visualize the subcellular localization of U23, using co-staining with markers for the trans-Golgi network (e.g., anti-CD107) to confirm its localization .

  • Flow cytometry: If studying cell surface expression, though U23 primarily localizes to the trans-Golgi network rather than the cell surface .

How can one investigate potential interactions between U23 and other viral or cellular proteins?

To investigate potential protein-protein interactions involving U23, researchers can employ the following methods:

  • Co-immunoprecipitation: Express tagged versions of U23 (e.g., FLAG-U23) in cells, followed by immunoprecipitation and mass spectrometry to identify binding partners .

  • Surface plasmon resonance (SPR): For quantitative measurement of binding affinities between purified U23 and candidate interactors, similar to the approach used to characterize U20-ULBP1 interactions .

  • Confocal microscopy co-localization: Perform double immunofluorescence staining of U23 along with candidate interacting proteins and calculate Pearson coefficients to quantify co-localization .

  • Proximity ligation assays: To detect protein-protein interactions in situ with high sensitivity in infected cells.

  • Yeast two-hybrid screening: For unbiased identification of potential cellular interaction partners.

What approaches can be used to study the functional significance of U23 during HHV-6B infection?

Despite being nonessential for in vitro replication, U23 may play important roles in pathogenesis. The following approaches can help elucidate its function:

  • CRISPR-Cas9 genome editing: Generate U23-knockout or U23-mutant viruses using CRISPR-Cas9 targeting, similar to approaches used for U20 and U21 . Specific guide RNAs would need to be designed targeting the U23 gene.

  • Overexpression studies: Express U23 in cell lines and assess effects on cellular processes such as immune receptor expression, signaling pathways, or responses to stimuli.

  • Transcriptome and proteome analysis: Compare gene expression and protein profiles between wild-type and U23-deficient virus infections to identify pathways affected by U23.

  • In vivo models: While challenging due to the species-specificity of HHV-6B, humanized mouse models or in vitro organoid systems could be utilized to study U23's role in a more physiological context.

What are the challenges in generating antibodies against HHV-6B U23?

Generating specific antibodies against HHV-6B U23 presents several challenges:

  • Cross-reactivity with HHV-6A U23: Due to high sequence homology between HHV-6A and HHV-6B U23 proteins, antibodies may cross-react. Epitope mapping and careful validation are required to ensure specificity .

  • Glycosylation: As U23 is a glycoprotein, differences in glycosylation between recombinant and native proteins may affect antibody recognition. Consider using recombinant U23 expressed in mammalian systems as immunogens to preserve natural glycosylation patterns .

  • Validation strategies: Validate antibody specificity using U23-knockout viruses or cells expressing tagged U23 constructs. Western blotting under both reducing and non-reducing conditions should be performed to assess epitope accessibility .

How can researchers overcome the technical difficulties in studying U23 in the context of viral infection?

Studying U23 during actual HHV-6B infection presents several challenges:

  • Limited tropism: HHV-6B primarily infects CD4+ T cells, complicating in vitro studies. Use established susceptible cell lines like Molt-3 T cells for infection studies .

  • Infection efficiency: Monitor infection rates using markers like viral gB protein by flow cytometry to accurately interpret results .

  • Temporal expression: As a late gene, U23 expression may be limited in experimental settings that don't support full viral replication. Use appropriate time points (48-72 hours post-infection) for analysis .

  • Distinguishing from other viral proteins: When studying the transcriptome or proteome, ensure specific identification of U23 amid the complex viral expression profile. RNA-seq approaches coupled with specific primers for RT-PCR validation can help achieve this specificity .

What are the most promising approaches to determine the function of U23 in HHV-6B pathogenesis?

Despite being nonessential for in vitro replication, U23 may play important roles in vivo:

  • Comparative studies with other herpesviruses: Investigate whether U23 has functional similarities to glycoproteins from other herpesviruses, particularly those localizing to the trans-Golgi network.

  • Systems biology approaches: Integrate transcriptomic, proteomic, and interactomic data to place U23 within the context of viral and host protein networks during infection.

  • Cell-type specific effects: Examine whether U23 has different functions in various cell types infected by HHV-6B, potentially explaining its conservation despite being nonessential for basic replication.

  • Interplay with other viral proteins: Investigate potential functional interactions between U23 and other viral proteins, particularly those in the U20-U26 gene cluster that collectively may orchestrate immune evasion .

How might studying U23 contribute to understanding HHV-6B-associated diseases?

HHV-6B has been associated with various clinical conditions, particularly in immunocompromised patients:

  • Transplant complications: Investigate whether U23 plays a role in HHV-6B reactivation in transplant recipients, where the virus can cause encephalitis and other complications .

  • Viral persistence mechanisms: Study whether U23 contributes to viral persistence and latency establishment, potentially through modulation of cellular trafficking pathways given its trans-Golgi localization .

  • Immune modulation: Examine whether U23 has subtle effects on immune recognition that might become important in specific disease contexts, even if not as prominent as the effects of U20 or U21 .

  • Potential therapeutic target: Despite being nonessential for in vitro replication, U23 might represent a target for antivirals if it proves important for in vivo pathogenesis or specific disease manifestations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.