Recombinant Human herpesvirus 6B Protein U91 (U91)

Shipped with Ice Packs
In Stock

Description

Definition and Genetic Context

Recombinant Human Herpesvirus 6B Protein U91 (U91) is a viral protein encoded by the U91 open reading frame (ORF) within the HHV-6B genome. The U91 gene resides in the unique long (UL) region of the viral genome and is part of a gene cluster (U86–U100) exhibiting high sequence divergence between HHV-6A and HHV-6B strains .

Key Genetic Features:

  • Splicing Variability: U91 undergoes alternative splicing, with strain-specific differences. In the HHV-6B Z29 strain, a unique splice site introduces an early stop codon, truncating the C-terminal domain compared to other strains .

  • Phylogenetic Divergence: The U90-U91 genomic region is among the most divergent in HHV-6B, with nucleotide identity as low as 72% compared to HHV-6A .

Functional Insights

U91’s role remains enigmatic, but emerging data suggest potential contributions to viral latency and reactivation:

  • Transcriptional Dynamics: U91 is classified as a late gene, with expression peaking 48–72 hours post-infection in Molt-3 T cells .

  • Reactivation Marker: During HHV-6A transactivation induced by histone deacetylase inhibitors, U91 transcripts are upregulated alongside U90 and U77/U79 .

  • Strain-Specific Behavior: The truncated U91 in the Z29 strain lacks functional domains present in other HHV-6B strains, potentially altering immune evasion strategies .

Expression and Immunogenicity

  • Recombinant Expression: U91 has been cloned and sequenced from clinical isolates, revealing strain-specific splice variants. For example, the Z29-1 cDNA splice site disrupts the C-terminal half of U91 .

  • Antibody Response: Chromosomally integrated HHV-6B (iciHHV-6B) individuals show elevated antibody titers against U90 and U100, but U91’s immunogenicity remains uncharacterized .

Comparative Genomics

  • Annotation Discrepancies: Disparities exist between HHV-6B Z29 and HST genomes, particularly in U91 splicing patterns .

  • Evolutionary Pressure: The U90-U91 region exhibits higher nonsynonymous mutation rates, suggesting host-driven selection .

Applications and Implications

Recombinant U91 is primarily used to study:

  1. Viral Latency Mechanisms: Interactions between U91 and host telomeric integration factors .

  2. Diagnostic Development: Strain-specific serological assays to distinguish HHV-6A/B infections .

  3. Therapeutic Targets: Potential role in viral reactivation pathways .

Unresolved Questions

  • Does truncated U91 in the Z29 strain impair viral fitness or immune evasion?

  • What host proteins interact with U91 during latency?

  • How does U91 contribute to HHV-6B’s unique telomeric integration mechanism?

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
U91; Protein U91
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Target Names
U91
Target Protein Sequence
MMGYEEKVSATGKTRLKILACLIVLILAAAITMLTLEIISNQKRTTTDLEAVTVALKHVS TSLANCTESTTSVHTANPRKNKESRKKIEGKSPSWVQALTTASGIILLFCIMMIFITCSW TTEKDTEKSEVQSYASSVETLDSLNEAIIPKTEMNV
Uniprot No.

Target Background

Database Links

KEGG: vg:1497088

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the functional role of U91 protein in Human herpesvirus 6B pathogenesis?

The U91 protein of HHV-6B is primarily involved in viral replication and immune modulation. Unlike the more extensively studied U94 protein, which is known to inhibit angiogenesis and modulate HLA-G expression , U91 appears to function in viral gene regulation during both lytic infection and latency phases. The protein contains sequence motifs suggesting DNA-binding capabilities, potentially allowing it to interact with host cellular processes. It contributes to the virus's ability to establish long-term infection by potentially interfering with normal cellular functions. Research methodologies to study U91's role typically include targeted gene knockout experiments, protein-protein interaction assays, and infection models with U91-deficient viral constructs.

How does U91 protein structure compare to other HHV-6B regulatory proteins?

U91 has a unique structure among HHV-6B proteins, characterized by specific domains that enable its regulatory functions. Unlike U94, which shares homology with the AAV-2 rep gene and demonstrates DNA binding capabilities involved in inhibition of angiogenesis , U91 possesses different structural motifs. To study these structural differences, researchers typically employ X-ray crystallography, nuclear magnetic resonance spectroscopy, and computational modeling approaches. These methods allow for precise determination of protein folding patterns, active sites, and potential interaction surfaces. Comparative analysis with other viral regulatory proteins such as HHV-6B p41 early antigen or p98 late antigen can provide insights into evolutionary relationships and functional specialization.

What are the expression patterns of U91 during different stages of HHV-6B infection?

U91 exhibits distinct temporal expression patterns throughout the HHV-6B replication cycle. The protein appears to be expressed during the early-intermediate phase of viral replication, approximately 24-48 hours post-infection, distinguishing it from immediate-early proteins that are synthesized within the first few hours and late proteins that appear after 48-72 hours . To accurately characterize these expression patterns, researchers employ time-course experiments with quantitative PCR, Western blotting, and immunofluorescence microscopy. Cell synchronization techniques, coupled with flow cytometry, allow for precise correlation between U91 expression and specific phases of the viral replication cycle, which typically completes within 72 hours .

What are the optimal expression systems for producing recombinant HHV-6B U91 protein?

The production of recombinant U91 protein requires careful consideration of expression systems to ensure proper folding and post-translational modifications. While bacterial systems (E. coli) offer high yield and simplicity, mammalian expression systems (typically HEK293 or CHO cells) provide superior post-translational modifications that may be essential for U91 functionality. The experimental design should include optimization of codon usage, selection of appropriate fusion tags (His, GST, or MBP) for purification, and validation of protein conformation . When designing such experiments, researchers should implement factorial designs to systematically test multiple variables, including induction conditions, temperature, and harvesting time . The experimental approach should include appropriate controls to ensure the recombinant protein retains native functions, particularly when studying interactions with host cellular components.

How should researchers design experiments to study U91 interactions with host cellular factors?

To elucidate U91's interactions with host cellular factors, researchers should implement multi-method approaches. Initially, protein-protein interaction screening techniques such as yeast two-hybrid or co-immunoprecipitation followed by mass spectrometry can identify potential interaction partners. Subsequent validation requires more targeted approaches including FRET/BRET assays, surface plasmon resonance, or isothermal titration calorimetry to quantify binding affinities . The experimental design should include both positive controls (known protein interactions) and negative controls (non-interacting proteins) to establish specificity. Additionally, researchers should consider the cellular compartmentalization of interactions, as HHV-6B proteins may function differently depending on their localization within infected cells. Experimental designs should systematically manipulate independent variables (protein concentration, cellular conditions) while measuring dependent variables (binding affinity, functional outcomes) with careful control of extraneous variables that might confound results .

What controls are essential when studying the immunomodulatory effects of recombinant U91?

When investigating U91's immunomodulatory properties, researchers must implement rigorous control measures. Essential controls include: 1) heat-inactivated U91 to distinguish between specific protein activity and contaminant effects; 2) other HHV-6B proteins (particularly U94) to determine protein-specific versus general viral effects ; 3) endotoxin-free preparations to avoid LPS-mediated immune activation; and 4) mock transfections/treatments to account for delivery method effects. The experimental design should incorporate both in vitro systems (primary immune cells, cell lines) and, where possible, ex vivo or in vivo models. Statistical design should include randomization of experimental units, blinding of analysis where applicable, and appropriate sample sizes based on power calculations to detect biologically meaningful effects . Additionally, time-course experiments are crucial for capturing the dynamic nature of immune responses to viral proteins.

How can CRISPR-Cas9 technology be applied to study U91 function in the context of HHV-6B genome?

CRISPR-Cas9 technology offers unprecedented precision for studying U91 function within the complete viral context. Researchers can design guide RNAs targeting the U91 gene region to create specific mutations, deletions, or insertions. The methodology requires careful design of guide RNAs with minimal off-target effects, typically using computational algorithms to predict specificity. The experimental approach should include: 1) construction of CRISPR-Cas9 plasmids targeting U91; 2) delivery into HHV-6B genome-containing cells; 3) selection and verification of edited clones; and 4) functional characterization comparing wild-type and U91-modified viruses. Key parameters to measure include viral replication kinetics, expression of other viral genes, effects on host cell processes similar to those observed with U94 , and pathogenesis in relevant models. Researchers should implement controls including non-targeting guide RNAs and rescue experiments where the U91 gene is reintroduced to confirm phenotypic changes are specific to U91 disruption.

What methodologies are most effective for studying U91's potential role in HHV-6B latency and reactivation?

Investigating U91's role in viral latency and reactivation requires specialized methodologies that capture the dynamic nature of these processes. Effective approaches include: 1) development of inducible expression systems where U91 can be selectively expressed or repressed; 2) establishment of in vitro latency models using T-lymphocytes, the primary site of HHV-6B latency ; 3) ChIP-seq analysis to identify U91 binding sites on viral and host genomes during latency and reactivation; and 4) single-cell RNA-seq to characterize heterogeneity in cellular responses to U91 expression. The experimental design should include time-course analyses to capture the transition between latency and reactivation states, with careful attention to cell viability and spontaneous reactivation rates as confounding factors. Researchers should implement comparative analyses with other latency-associated viral proteins and measure indicators of viral reactivation, including expression of immediate early genes and production of infectious virions.

How can structural biology approaches be applied to develop U91-targeted antiviral strategies?

Advanced structural biology techniques offer powerful tools for developing U91-targeted antivirals. The methodology should progress from structure determination (X-ray crystallography, cryo-EM, or NMR spectroscopy) to identification of druggable pockets through computational analysis. This multi-step approach includes: 1) expression and purification of U91 protein domains; 2) high-resolution structural analysis; 3) in silico screening of compound libraries against identified binding pockets; 4) biochemical validation of top candidates; and 5) testing in cellular infection models. Researchers should design experiments that incorporate positive controls (known viral inhibitors) and utilize structure-activity relationship studies to optimize lead compounds. The experimental design should evaluate both direct inhibition of U91 function and potential allosteric effects that might disrupt protein-protein interactions identified earlier. Effective assays will measure compound binding affinity, specificity against related viral proteins, effects on U91 function, and ultimately antiviral activity in appropriate cell culture systems.

How should researchers interpret contradictory findings regarding U91 function across different cell types?

When facing contradictory results about U91 function in different cellular contexts, researchers should implement a systematic analytical approach. First, evaluate methodological differences that might explain discrepancies, including cell type-specific factors, protein expression levels, and experimental conditions. HHV-6B demonstrates broad cellular tropism , suggesting U91 may have cell type-specific functions similar to other viral proteins. The analytical framework should include: 1) side-by-side comparison experiments using standardized protocols across multiple cell types; 2) examination of cell type-specific protein-protein interactions; 3) assessment of post-translational modifications that might differ between cell types; and 4) evaluation of cellular background effects using knockout/complementation approaches. Researchers should consider implementing factorial experimental designs that can identify interaction effects between cell type and other experimental variables . Additionally, meta-analysis approaches can help determine whether contradictions represent genuine biological variability or methodological inconsistencies across studies.

What statistical approaches are most appropriate for analyzing U91 protein interaction networks?

Analysis of U91 protein interaction networks requires specialized statistical frameworks that account for the complexity of biological systems. Appropriate approaches include: 1) network analysis metrics (centrality measures, clustering coefficients) to identify key interaction hubs; 2) enrichment analyses to determine over-represented biological pathways; 3) Bayesian networks to infer causal relationships; and 4) machine learning algorithms to predict functional consequences of interactions. When designing such analyses, researchers should implement appropriate controls for false discovery rate in high-throughput datasets and validate key interactions through orthogonal methods. The statistical approach should include sensitivity analyses to determine robustness of network structures to experimental noise and sampling variations. Comparison with interaction networks of other HHV-6B proteins, particularly the well-studied U94 , can provide context for interpretation and identify unique versus shared host interfaces.

How can researchers differentiate between direct effects of U91 and secondary consequences of viral infection?

Distinguishing direct U91 effects from secondary viral infection consequences requires carefully designed experimental approaches. Recommended methodologies include: 1) comparison between wild-type virus and U91-deficient mutants; 2) ectopic expression of U91 in the absence of other viral proteins; 3) time-course experiments to establish temporal relationships between U91 expression and observed effects; and 4) dose-response studies to identify concentration-dependent relationships. The experimental design should systematically manipulate U91 expression while controlling for other viral factors, similar to approaches used in studying U94's angiogenesis inhibition properties . Researchers should implement statistical approaches that can identify direct versus indirect relationships, including mediation analysis and structural equation modeling. Additionally, molecular approaches such as direct binding assays can provide evidence for immediate molecular interactions versus downstream signaling events that represent secondary effects.

How can U91 research contribute to understanding HHV-6B's role in human disease beyond primary infection?

Research on U91 offers significant insights into HHV-6B's long-term impacts on human health. Methodological approaches should include: 1) comparative analysis of U91 sequence and expression in clinical isolates from various disease states; 2) examination of U91-specific immune responses in patients with suspected HHV-6B-associated conditions; 3) investigation of U91 interactions with cellular pathways implicated in disease pathogenesis; and 4) development of animal models expressing HHV-6B U91. This research is particularly relevant given evidence that HHV-6 may play roles in malignancies such as Hodgkin's lymphoma . The experimental design should include appropriate disease controls and age-matched comparisons, as HHV-6B infection patterns and consequences differ by age group . Researchers should implement longitudinal studies where possible to capture the temporal relationship between U91 expression/activity and disease progression, with careful documentation of potential confounding factors such as co-infections or treatments.

What approaches best measure the immunogenicity of recombinant U91 for vaccine development purposes?

Assessing U91's potential as a vaccine target requires comprehensive immunogenicity evaluation. The methodology should include: 1) epitope mapping to identify immunodominant regions; 2) evaluation of both humoral and cell-mediated immune responses using ELISpot, intracellular cytokine staining, and antibody neutralization assays; 3) assessment of cross-reactivity with related herpesviruses; and 4) determination of conservation across clinical isolates. The experimental design should incorporate appropriate adjuvants and delivery systems, with careful randomization to experimental groups . Researchers should implement true experimental designs with control groups receiving either no immunization or irrelevant antigens . Statistical analysis should include measures of response magnitude, quality (antibody affinity, T cell polyfunctionality), and duration, with appropriate consideration of individual variation. Success metrics should include not only immunogenicity but also functional assays measuring protection against viral challenge in relevant models.

How should researchers analyze U91's potential interactions with other viral proteins in co-infection scenarios?

Analyzing U91's role in co-infection contexts requires specialized experimental approaches that account for inter-viral interactions. Effective methodologies include: 1) controlled sequential and simultaneous infection models; 2) co-expression systems for multiple viral proteins; 3) competitive binding assays to identify shared cellular targets; and 4) transcriptomic/proteomic analyses to characterize global cellular responses to co-infection. The experimental design should systematically vary infection parameters (timing, viral load, sequence) while measuring U91 expression, localization, and function compared to single-infection controls. Researchers should implement factorial experimental designs to identify interaction effects between viruses . This approach is particularly relevant given HHV-6's potential interactions with other herpesviruses in conditions like Hodgkin's lymphoma, where HHV-6 and EBV co-infection has been documented . Analysis should focus on identifying synergistic, antagonistic, or independent effects between viral proteins from different pathogens, with careful attention to spatial and temporal dynamics within infected cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.